KEGG   Rhodococcus sp. PBTS 1: A3Q40_02847Help
Entry
A3Q40_02847       CDS       T05182                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00260  Glycine, serine and threonine metabolism
rhu01100  Metabolic pathways
rhu01110  Biosynthesis of secondary metabolites
rhu01120  Microbial metabolism in diverse environments
rhu01130  Biosynthesis of antibiotics
rhu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A3Q40_02847 (ltaA)
Enzymes [BR:rhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A3Q40_02847 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 LytR_C
Motif
Other DBs
NCBI-ProteinID: AMY20210
UniProt: A0A143QAS2
Position
3070535..3071557
Genome map
AA seq 340 aa AA seqDB search
MAALPRIDLRSDTVTVPDDEMRRAMAAADVGDDVLDHDPTMAALEEEVAAVLGMPAALWM
PSGTMGNVAALMMHLQRGDKFLAPEHAHVLGSELGSAAWLAQGMPDVLPHDGGPGRPTPA
SVRAHVAPGPYFSLRTTLLCLENTHNFAGGTVTPVSEWRALTAAATESGLVVHLDGARLW
NAAAALGVDPAELTTGAATVQVCLSKGLGAPVGSVLVSDAVRIAEARRIRKMLGGGVRQG
GVLAAAGLVALRSRDRLDDDHAHARQLADGLRERGWAVDEPETNIVLATTEDPAATVRAL
AAAGVGAVTVAGRVRFVTHRGISAEDIDAALAACAALPTA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtggctgccctcccgcgaatcgacctccgctccgacaccgtgaccgtccccgacgacgag
atgcgccgcgccatggccgcggccgacgtcggcgacgacgttctggaccacgaccccacc
atggcagcgctcgaggaggaggtcgccgcggtcctggggatgccggccgccctgtggatg
cccagcggcaccatgggcaacgtcgcggcgctgatgatgcatctgcagcgcggcgacaag
ttcctcgctccggagcacgcgcacgtgctcggctcggaactcggttcggccgcctggctc
gcgcagggcatgccggacgtgctgccgcacgacggcggccccggccggccgacacccgcg
tcggtccgggcccacgtcgcacccggcccctacttctcgctgcgcaccacgctgttgtgc
ctcgagaacacccacaacttcgcgggcggcaccgtcaccccggtgagcgagtggcgcgcg
ctcacggccgcggcgacggagagcgggctcgtggtccacctcgacggggctcggctgtgg
aacgccgccgcggctctgggcgtcgaccccgcggagctgaccaccggggcggcgaccgtc
caggtgtgtctgagcaagggcctcggcgccccggtgggctcggtgctcgtgtccgacgcc
gtgcggatcgcggaagcccgccgcatccggaagatgctcggcggcggggtgcgccagggc
ggtgtgctcgcggcggcggggctggtggccctgcgctcgcgggaccgtctggacgacgac
cacgcgcacgctcgacagctcgccgacggcctgcgcgagcgcggctgggccgtcgacgag
ccggagacgaacatcgtcctggccaccacggaggatcccgcggccacggtccgggcgctc
gccgcggcgggcgtgggtgcggtgacggtggcgggccgagtgcgcttcgtgacccaccgg
ggcatctcggccgaggacatcgacgcggcgctggccgcgtgcgctgcgctgccgacggcg
tag

DBGET integrated database retrieval system