KEGG   Rhizobium sp. S41: BA939_10230Help
Entry
BA939_10230       CDS       T05451                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
rhv  Rhizobium sp. S41
Pathway
rhv00270  Cysteine and methionine metabolism
rhv00480  Glutathione metabolism
rhv01100  Metabolic pathways
Module
rhv_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:rhv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BA939_10230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA939_10230
Enzymes [BR:rhv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BA939_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ANV24275
Position
1:2125970..2126929
Genome map
AA seq 319 aa AA seqDB search
MAKIKNVAIQMDHVSGINIGGDSTFAMSLEAQARGYRLFHYTPDRLSMRDGKIYATVEQM
ELRDIKGDHFSLSEPERVDLSTMDVIHLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW
VRNSPEKIFVTEFADLMPKTLITKDVAEIARFRNEMGDIILKPLYGNGGAGVFHSARDDR
NFSSLLEMFDQMFREPYIAQEYLPDVRKGDKRILLVDGEPVGAINRVPAENDARSNMHAG
GRPEPTELTAREKEICRRIGPALRERGFLFVGIDVIGDYLTEINVTSPTGIREVRKFGGA
DVASLLWDAIEKKREAQDI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaagaacgtcgcgatccagatggatcatgtctccggcatcaacatcggc
ggtgattccaccttcgccatgagccttgaagcgcaggcgcgtggatatcggctgttccat
tacacgcccgaccgcctttccatgcgcgatggcaagatttacgcgaccgtcgagcagatg
gagctgcgcgacatcaagggtgaccatttctcgctttccgaaccggagcgcgttgatctg
tccacgatggatgtcatccatctgcgtcaggatccaccattcgacatggcctatattacc
tccacccatctgctggagcgcattcatccgaagaccctggtggtcaatgatcccgcctgg
gtgcgcaattcgccggagaagatcttcgtcactgaattcgcggatctcatgccgaagacg
ctgatcacgaaggatgtcgcggaaatcgcgcgcttccgtaacgaaatgggcgatatcatt
ctcaagccgctttatggcaatggcggtgcgggcgtctttcattcagcgcgggacgaccgc
aatttctcctcgctgctggaaatgttcgatcagatgttccgcgaaccttacattgctcag
gaatatctgcccgacgtccgcaagggcgataaacgcatcctgctggtggatggagagccg
gtgggtgcgatcaaccgcgttccagcggaaaacgatgcccgttccaacatgcacgctggc
ggccggcctgagcctacggaactgaccgcgcgcgaaaaggaaatctgccgccgtatcggc
cccgccctgcgcgagcgtggtttcctgttcgttggaattgatgtcattggcgattacctc
accgaaatcaacgtcacctcgccgaccggcattcgagaggtgcggaaattcggcggcgcc
gatgtggcgagcctgctgtgggacgccatcgagaaaaagcgcgaagctcaggatatttga

DBGET integrated database retrieval system