KEGG   Rhizobium sp. S41: BA939_18930Help
Entry
BA939_18930       CDS       T05451                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
rhv  Rhizobium sp. S41
Pathway
rhv00053  Ascorbate and aldarate metabolism
rhv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BA939_18930
Enzymes [BR:rhv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BA939_18930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ANV26049
Position
2:complement(916249..917046)
Genome map
AA seq 265 aa AA seqDB search
MLKRLLITGAGGKLGSMLRGRLGHVAETIRLSDVVDLGSPAPHEELVHCALEDEQAVYDL
VKDCDGIVHLGGISVERAFDPIEAANLRGVYNLYEAARAHGNPRILFASSNHTIGYYLQG
QQLSPETPFLPDGLYGVSKIFGEAMASLYHSKFGQETAIVRIGSCDETPTNWRMLSTWLS
YGDFVSLIEATFRVPKLGCPVIWGVSANDESWWDNSHVDFLGWQRRDNAARYRAEIERDV
PRPGPEAAIAKYQGGIFIDEPIHRT
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcgattgctcatcaccggtgccggcggcaagctgggcagcatgttgcgcggg
cggcttggccatgttgccgaaaccatccgtctttctgatgtggttgatctcggttcgcca
gcgccccatgaagagcttgtccactgcgcgctggaggacgagcaggcagtttacgatctg
gtcaaggactgcgatggcatcgttcatctcggcggcatttccgtcgagagggcgtttgat
cccatcgaagcggccaatctgcgtggtgtttacaatctttatgaggcggcgagggcacac
ggcaatccccgcatcctgttcgcctccagcaaccacacgatcggttattatctgcagggc
cagcaacttagccctgagacgccttttctgcctgatggcctctatggggtttcgaagatc
tttggcgaggccatggcaagcctctaccattccaaattcggacaggagacggccatcgtg
cgcatcggctcctgtgacgagacacccacgaactggcgcatgttgtcgacctggctcagc
tacggtgacttcgtctccctgatagaggcgaccttccgcgtgccaaaactcggctgcccg
gttatctggggcgtttcggccaatgacgagagctggtgggataattcccatgtcgatttt
ctcggctggcagcggcgcgacaatgccgcgcgttaccgggccgaaatcgagcgtgacgta
ccgcgccccggccccgaggcagcaatcgcaaaatatcagggcggcatttttatcgatgag
cccattcacaggacttga

DBGET integrated database retrieval system