KEGG   Rhodococcus sp. WMMA185: BFN03_00805Help
Entry
BFN03_00805       CDS       T04814                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00071  Fatty acid degradation
rhw00072  Synthesis and degradation of ketone bodies
rhw00280  Valine, leucine and isoleucine degradation
rhw00310  Lysine degradation
rhw00362  Benzoate degradation
rhw00380  Tryptophan metabolism
rhw00620  Pyruvate metabolism
rhw00630  Glyoxylate and dicarboxylate metabolism
rhw00640  Propanoate metabolism
rhw00650  Butanoate metabolism
rhw00900  Terpenoid backbone biosynthesis
rhw01100  Metabolic pathways
rhw01110  Biosynthesis of secondary metabolites
rhw01120  Microbial metabolism in diverse environments
rhw01130  Biosynthesis of antibiotics
rhw01200  Carbon metabolism
rhw01212  Fatty acid metabolism
rhw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFN03_00805
   00630 Glyoxylate and dicarboxylate metabolism
    BFN03_00805
   00640 Propanoate metabolism
    BFN03_00805
   00650 Butanoate metabolism
    BFN03_00805
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFN03_00805
   00072 Synthesis and degradation of ketone bodies
    BFN03_00805
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFN03_00805
   00310 Lysine degradation
    BFN03_00805
   00380 Tryptophan metabolism
    BFN03_00805
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFN03_00805
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFN03_00805
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BFN03_00805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhw04147]
    BFN03_00805
Enzymes [BR:rhw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BFN03_00805
Exosome [BR:rhw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFN03_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AOW94224
UniProt: A0A1D8T9D9
Position
215020..216408
Genome map
AA seq 462 aa AA seqDB search
MSKNSSQQVITPDPWRRSVTSKARTTSKSAAARKPRGKQQRPVAIVGGNRIPFARSDKAY
AQASNQDMFTATLDGLVSRFNLQGEKLGLVAGGAVLKHSRDFNLMRESVLGSALSPYTPA
FDLQQACGTGLASIVTVGDAIAAGRIDAGVGGGVDTTSDAPIGVNDELREFLLSLNRAKT
TGERIKLLGNVRPSMLGVEIPRNGEPRTGLSMGEHAAITAKEFGIRREDQDELAAASHKN
MAAAYDRGFFDDLVTPFLGLTRDDNLRPGSTVEKLATLKPVFGVKAGDATMTAGNSTPLT
DGASAVLLSSDEWAAERKLPVLAHLVDSETAAVDYIHGKDGLLMAPTYAIPRLLARNGLT
LQDFDFYEIHEAFASVVLATLQAFESEEYCKERLGLDGALGSIDRSKLNVNGSSLAAGHP
FAATGGRIVASLAKALAEKGSGRGLISICAAGGQGVTAIIEA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ctgagtaagaatagtagccaacaggtaatcacaccagatccttggagacgttcagtgacc
agcaaagctcgcaccacctcgaagtccgcagcagcgcggaagccacgcggaaagcagcag
cgtcccgtcgccatcgtcggcggaaatcgaattcccttcgcccgctccgacaaggcgtac
gcgcaggcgtccaaccaggacatgttcaccgcgaccctggacgggctggtgagccgcttc
aaccttcagggcgaaaagctgggcttggtagcgggtggcgccgtgctcaagcacagccgc
gacttcaacctgatgcgcgaatccgtgctcggtagcgcgttgagcccctacaccccggcg
ttcgacctgcagcaggcgtgcggcaccgggttggcgtcgattgtgaccgtcggtgatgcg
atcgcggccggacgtatcgatgccggagttggcggtggcgtcgacactacgtctgacgcc
ccgatcggcgtgaacgacgagcttcgcgagttcctgttgtcattgaaccgtgcgaagacg
actggcgaacgcatcaaactcctcggcaatgttcgcccctcgatgctcggcgtcgagatc
ccacgcaacggcgaaccccgcactgggctctcgatgggcgagcacgcagccatcacggcg
aaggagttcggcatccgccgtgaggaccaggacgaattggctgcggccagccacaagaac
atggccgccgcatacgaccgcggattcttcgatgatctggtgacgccgttcctgggcctc
acccgggacgacaacctgcgccccggctccaccgtcgagaagctggcgacgctgaagccg
gtgttcggggtaaaggcgggcgacgccacgatgacggcggggaactcgaccccgctcacc
gacggcgcgtctgcggtcttgctgtcgagcgacgagtgggctgccgagcgcaaactgccg
gtacttgcccatctcgtcgactccgagaccgcggccgtcgactacatccatggcaaggac
ggactcttgatggcgccgacgtacgccatcccgcgtctgctggcccgcaacggcctcacc
ttgcaggatttcgatttctacgagatccacgaagctttcgcatccgtcgtgctggcgacg
ctgcaggccttcgaatcggaggagtactgcaaggagaggctcggtctcgacggcgcactc
gggtctatcgatcggagcaagctgaacgtcaacggatcatcgttggcggcggggcacccg
ttcgctgcgacgggcggccgtatcgtcgcatcgctcgccaaggcgcttgccgagaagggg
tcaggacgtgggttgatctcgatttgcgcggccggcggacaaggtgtgacggcaatcata
gaggcgtga

DBGET integrated database retrieval system