KEGG   Rhodococcus sp. WMMA185: BFN03_01740Help
Entry
BFN03_01740       CDS       T04814                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00450  Selenocompound metabolism
rhw00970  Aminoacyl-tRNA biosynthesis
rhw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BFN03_01740
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BFN03_01740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhw01007]
    BFN03_01740
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rhw03016]
    BFN03_01740
Enzymes [BR:rhw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BFN03_01740
Amino acid related enzymes [BR:rhw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BFN03_01740
Transfer RNA biogenesis [BR:rhw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BFN03_01740
 Prokaryotic type
   Other AARSs
    BFN03_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AOW91847
UniProt: A0A1D8T2Q4
Position
complement(418196..419755)
Genome map
AA seq 519 aa AA seqDB search
MTSADSTASRPPFYLTTAIAYPNGVPHIGHAYEYISADALARFKRLDGFDVFFLTGTDEH
GLKMQQTAAKEGLDVRELATRNSDMFEAMDKALNISFDRFIRTTDADHEEASKAIWQKML
DNGDIYLDTYSGWYSVRDEAFYTEAETTLQEDGSRLSTETGTLVEWTEESTYFFRLSEYQ
DKLLSLYEENPDFIAPTTRRNEIVSFVKGGLKDLSISRTTFDWGVPVPGHPEHVMYVWVD
ALTNYLTGAGYPNTDSEQFGKFWPANLHIIGKDITRFHTVYWPAFLMSAGIELPERVFVH
GFLYNRGEKMSKSVGNVIDPVAMVEQYGLDAVRFFLLREISYGQDGSYSHEAIVTRINAD
LANELGNLAQRSLSMVAKNCDARVPSPAELTEDDTALLAQADALLARVRAEFDVQALHLG
LEAIWSVLGETNRYFSKQEPWVLRKTDPERMATVLYVTLEVVRIVGILVQPVMPDAAAKI
LDLLGQDAEARQFSDLRTRIVAGTPLPAPSGVFPRYVDE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgctgattccaccgcttcgcggccacccttctatctgacgacggcgatcgcg
taccccaacggcgtcccgcacatcggccacgcctacgagtacatctcggccgacgccctc
gcacggttcaagcgtctggacggtttcgacgtgttcttcctgaccgggaccgacgagcac
ggcctgaagatgcaacagaccgcggccaaggaaggcctcgacgtccgggaactcgccacg
cggaactccgacatgttcgaggcgatggacaaggccttgaacatctccttcgaccggttc
atccgtaccacggatgccgatcacgaagaagcgagcaaggcgatctggcagaagatgctc
gacaacggcgacatctacctagacacctactcgggctggtactcggtccgcgacgaggcc
ttctacaccgaggccgagaccacgctgcaggaagacggctcacgcctgtccaccgagacg
ggcacgctggtcgagtggaccgaggaatccacctacttcttcaggctgtccgaataccag
gacaagctgctgagcttgtacgaggagaacccggatttcatcgcgcccaccactcggcgc
aacgagatcgtcagcttcgtcaagggcggcctcaaagacttgtcgatctcgcgcacaacc
ttcgattggggcgtcccggtccccggacaccccgaacacgtcatgtacgtgtgggtcgat
gcgctcaccaactacctcaccggtgccggctacccgaacaccgattccgaacagttcggc
aagttctggcccgcgaacctacacatcatcggcaaggacatcacccggttccacaccgtg
tactggcccgcgttcctgatgtcggcgggaatcgagctgcccgaacgggtcttcgtgcac
ggattcctctacaacaggggcgagaagatgtcgaagtcggtcggcaacgtcatcgacccc
gtcgcgatggtggaacagtacggactcgatgccgtccgcttcttcctgctccgcgagatc
tcctacggccaggacggcagctacagccacgaggccatcgtcacgcgcatcaacgccgac
ctcgccaacgaactcggcaacctcgcgcagcgctcgctgtcgatggtggcgaagaactgc
gacgcccgcgttccgagccccgcagaactcaccgaggacgacaccgcgctgctggcacag
gccgatgcgttgctggcccgggttcgcgccgagttcgacgtccaagcgctgcatctcggg
ctggaagcgatctggtcggtcctcggcgagacgaaccggtacttctccaagcaggaaccc
tgggtactgcggaagaccgaccccgagcggatggcgacggtactgtacgtgacgctcgaa
gtggtgcgaatcgtcggcatcctggtgcagccggtgatgccggacgcagccgcgaagatc
ctcgatctcctgggccaggatgccgaggcgcgccagttcagcgacctgcgcactcgcatc
gtcgcgggaaccccgctacctgcaccgtcgggcgtgttccctcgctacgtggacgagtga

DBGET integrated database retrieval system