KEGG   Rhodococcus sp. WMMA185: BFN03_01860Help
Entry
BFN03_01860       CDS       T04814                                 

Definition
(GenBank) ergothioneine biosynthesis protein EgtC
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00340  Histidine metabolism
rhw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BFN03_01860
Enzymes [BR:rhw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     BFN03_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AOW91864
UniProt: A0A1D8T2Q9
Position
443853..444599
Genome map
AA seq 248 aa AA seqDB search
MCRHLGYLGPDQSVGDLLVQGENSLLNQSFAPRDMRGGGTINADGFGVGWWGADGFSRYR
SDQPLWSDPALQETLPSIHSGAVVAAARSATVGMPVQRTACAPFSDDEWAFSHNGVVTRW
PESLGELAADLPSTDLLQLEAPTDSAALWLLLRRLLGEYDPEKALATLVTAVIAAAPQSR
LNLLLGNGQELWATTWYHSLSAFVDDERAIVSSEPYDDDPNWQAIPDRHLVVARPGHLIV
TPLEIGAS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgacacctgggctatctggggccggaccaatcggtaggcgatctcctcgttcaa
ggagagaactcgctgttgaaccaatcgtttgcgccgcgtgacatgcgtggcggcggaacg
atcaacgcagatgggttcggtgtggggtggtggggggcggacgggttctcgcgctaccgc
agcgatcagccgctctggtccgatcccgctctgcaggagaccttgccgagcattcattcc
ggtgccgtcgtcgctgcagcgcgttcggcgacggtcggaatgccggtgcagcgcactgca
tgtgcaccgttctcggacgacgagtgggcgttcagtcacaacggggtcgtaaccagatgg
ccggaatctctcggagaactggccgccgacctgccgtctaccgatctgctccagctcgag
gcaccgaccgattcggcggcgttgtggctactgctacgacgcctgctaggcgagtacgac
cccgaaaaggccctggccaccctcgtcaccgccgtgattgccgccgcgccgcagtcacga
ttgaacctgctattgggaaacggccaggaactatgggccaccacctggtatcactcgctg
tccgcgttcgtggacgacgagcgggccatcgtcagttccgaaccctatgacgacgatccg
aattggcaagcaatcccggaccggcacctcgtggttgcgcgcccggggcacctgatagta
acgccgctcgagattggagcctcatga

DBGET integrated database retrieval system