KEGG   Rhodococcus sp. WMMA185: BFN03_03145Help
Entry
BFN03_03145       CDS       T04814                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00471  D-Glutamine and D-glutamate metabolism
rhw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BFN03_03145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhw01011]
    BFN03_03145
Enzymes [BR:rhw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BFN03_03145
Peptidoglycan biosynthesis and degradation proteins [BR:rhw01011]
 Precursor biosynthesis
  Racemase
   BFN03_03145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AOW94357
UniProt: A0A1D8T9N0
Position
737986..738726
Genome map
AA seq 246 aa AA seqDB search
MLPTSARLRLRRPDLDLILALDPDGAPWGPKSGRWVIDRVLATVKLTLDRGADVIVLPCN
TASVTALEHVREFVGPQVPVIGTVPAIKPAAAACESVAVWATEATTASRYQADLIERFGN
GSSVVAVACHGLADAIDLGEREAATAAIVSAVARTPEDVGGVVLGCTHYPLMADEIAEKL
PTGVRLFDSAEAVASQTLRRIDALGRPSTGKGRVEVLLSGRPGRLPPSAEVFPAGRLLSE
GNTQPS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgacgtcggcgcggcttcgtttgcgcagacccgacctggatctgattctcgct
ctggacccagacggggccccgtggggtccgaaatcggggcggtgggtgatcgatcgtgtc
ctcgcgaccgtgaagttgacgctcgaccgtggtgcggatgtgatcgtgctgccgtgcaac
acggcgagtgtcaccgcgctcgagcatgtccgagaattcgtcggaccgcaggttccggtc
atcggtacggttcccgcgatcaaacctgctgcggcggcatgtgagtctgtggcggtgtgg
gcgaccgaggcgacgactgcgagtcgatatcaggcagatctcatcgagcgtttcggcaac
ggaagttctgtggtggctgtcgcgtgccacggcctcgccgatgccatcgatctcggcgaa
cgggaggcggccaccgcggccatcgtctcggctgtcgcacgcacacccgaggacgtggga
ggggtggtgcttgggtgtacgcactacccgctgatggctgacgagatcgcggagaagctc
ccgaccggggtgcgactgttcgacagcgccgaagcggtggcatcgcagacgcttcgtcgc
atcgacgcgctcggccgtccgagtaccggtaagggcagagtcgaggtcctgctcagtggc
cgaccgggacgtctgccgccgagcgctgaagtcttcccagccgggcggttgctgtccgaa
ggaaacactcagccgagttga

DBGET integrated database retrieval system