KEGG   Rhodococcus sp. WMMA185: BFN03_07610Help
Entry
BFN03_07610       CDS       T04814                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BFN03_07610
Enzymes [BR:rhw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BFN03_07610
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BFN03_07610
    1.1.1.-  
     BFN03_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Shikimate_DH ADH_zinc_N_2 Pyr_redox_2 Sacchrp_dh_NADP Pyr_redox FAD_binding_3 TrkA_N 2-Hacid_dh_C NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOW92607
UniProt: A0A1D8T4W5
Position
1688353..1689435
Genome map
AA seq 360 aa AA seqDB search
MKAARWFGRGEITVVDIAAPVPTPEQALLRVLWCGICGSDLEEYRNGPLTIPVTHPHPGS
GRVAPITLGHEVVAVVEQAAADGSGFPAGTVVIPDVVVGCGTCWWCNRHDEGLCPQLTVL
GLHDDGGLAEYMVARADRCVPVPPSLDPAHAALAEPTAVAVRALDKVPRILGSTVLILGG
GTTGLLIAQIARSHGAEAVFVVDVRDDRLKLAEQLGASPIRPDELSALLASLPEPGIDTV
LECSGSPGLLNRAVQAVRPGGTVIAVGLHGGDGPVDIPALVIGERRILGTAAHMYDVDVR
AAVQLLAAGTVDPKPLITHRIPLDDTAPVALPLLADPAAGAVKVLINCSGETGPETENPP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcccggtggttcggtcgcggcgagatcaccgtcgtcgacatcgcggcgccg
gtacctacgccggagcaagcgctgctgcgagtcctgtggtgcggcatctgcggctccgac
ctcgaggagtaccgaaacgggccgctgaccatcccggtgacccaccctcacccgggcagt
ggacgggtcgcccccatcactctcggtcacgaggtagttgccgtcgtggaacaggctgcc
gctgatggcagcggattccccgcaggcaccgtcgtcatccccgacgtcgtcgtcggctgc
ggaacctgttggtggtgcaatcgccacgacgaaggactgtgcccgcagctcacggtgctc
ggtctacacgatgacggcggcctcgccgaatacatggtcgcccgagccgaccgctgtgta
ccggttccgccctcgctcgaccccgcccacgccgcgcttgccgaacccaccgccgtggcc
gtgcgcgccctcgacaaggtgccgcgcatcctcggttccaccgtcctgatcctcggcggc
gggaccaccggactcctcatcgcccagattgcccgtagtcacggcgccgaggcagtcttc
gtcgtcgacgttcgcgacgatcgcctgaaactcgccgagcagctcggggccagcccaatc
cgcccagatgagctgtccgcgctgctggcctccctgccggaaccgggaatcgacacggta
ctggaatgttcaggcagccctggtctgctcaatcgggccgtgcaagccgtccgcccgggc
ggcaccgtcatcgcggtcgggctacatggtggtgacgggccggtcgacattccagcgctc
gtcatcggggaacggcgcatactcggcaccgccgcgcacatgtatgacgtcgacgtccgc
gccgccgtccaacttctggctgcaggcacagttgaccccaaaccgcttatcacacaccgt
atcccgctcgacgacacggctcccgtcgccctgccactgctcgccgaccccgcggccggt
gcggtgaaggtgctcatcaactgctccggagaaaccggaccggaaaccgaaaatccgcca
tag

DBGET integrated database retrieval system