KEGG   Rhizobium sp. N731: AMK02_CH02224Help
Entry
AMK02_CH02224     CDS       T04809                                 

Gene name
metG-2
Definition
(GenBank) methionyl-tRNA synthetase 2
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00450  Selenocompound metabolism
rhx00970  Aminoacyl-tRNA biosynthesis
rhx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMK02_CH02224 (metG-2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AMK02_CH02224 (metG-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhx01007]
    AMK02_CH02224 (metG-2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rhx03016]
    AMK02_CH02224 (metG-2)
Enzymes [BR:rhx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AMK02_CH02224 (metG-2)
Amino acid related enzymes [BR:rhx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AMK02_CH02224 (metG-2)
Transfer RNA biogenesis [BR:rhx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AMK02_CH02224 (metG-2)
 Prokaryotic type
   Other AARSs
    AMK02_CH02224 (metG-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ANK85806
Position
complement(2222676..2224226)
Genome map
AA seq 516 aa AA seqDB search
MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQ
TARAEGISAQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWKLMADNGDIY
KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDRLLAHY
EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYIT
ATGYIEDKNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKG
EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGN
LASRSLSMIVKNCDGKIPECGPLTDEDKAMLAQADALHASTREDMGKQLIHRALASIISV
VSEADRYFAGQAPWALKKTDPARMGTVLYVTAEVVRQIAILLQPFMPESSGKLLDLVAAP
ADKRDFAALGEAGRLVTGTALEAPAPVFPRYVAPEA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagacacccttctacatcaccaccgcgatttcctatcccaacggcaagccg
catatcggccacgcctatgagctgatcgcgacggatgcgatggcgcgctaccagcgcctg
gacggcagggatgtcttcttcctgacgggcaccgacgaacacggccagaagatgcagcag
acggcgcgcgccgaaggaatctccgcgcaggcgcttgccgaccgcaactccggcgaattc
caggcgatggcgaagctgctcaacgcctccaacgatgacttcatccgcaccacgcaggag
cgtcatcacgagacgtcgcggaatatctggaaactgatggccgacaatggcgacatctac
aaggacagctatgccggctggtattcggtgcgcgacgaggcctattatcaggaaaatgag
acggagctgcgcgccgacggcgtacgttacggcccgcaaggcacgcccgtcgagtgggtg
gaagaggcaagctatttcttcaagctctccgaataccaggacaggctgcttgcccattac
gaggccaatcccgatttcatcggtccggccgaacgccgcaacgaggtgatctccttcgtc
aagtcgggcctcaaggacctgtcggtgtcgcgcacgaccttcgattggggcatcaaggtg
ccgaacgacccgtcgcatgtcatgtatgtctgggtggacgcgctgaccaactacatcacg
gcgacgggctatatcgaggacaagaatggtccgagggcgaagtactggccggcggatgtg
cacatcatcggcaaggacatcatccgcttccacgcggtctattggccggccttcctgatg
tcggcgaagctgccgctgccgaagcgggtctttgcccacggcttcctgctcaacaagggc
gagaagatgtcgaagtcgctcggcaacgtcgtcgatcccgtcaatctggtgaatcatttc
ggtctcgatcaggtgcgctacttcttcctgcgcgaagtttccttcggccaggacggcagc
tatagcgaagaggcgatcggcacacgcatcaactccgacctcgccaacggcatcggcaat
ctcgccagcaggtcgctgtcgatgatcgtcaagaattgcgacggcaagatcccggaatgc
gggccgctgaccgacgaggacaaggcgatgctggcccaggctgacgcgctgcatgcatcg
acgcgcgaggacatgggcaagcagctcatccatcgcgctctcgcctcgatcatttcagtc
gtttcggaggccgatcgctatttcgccggccaggcgccctgggcgctgaagaagacggat
ccggcgcggatgggcacggtgctgtacgtcacggccgaggtggtgcgccagatcgccatc
ctgttgcagcccttcatgccggaatcatccggcaagctgctcgatctcgtggccgcgcct
gccgacaagcgcgattttgccgcgcttggcgaggctggccgtcttgttaccgggacggcg
ctcgaagcgccggcgccggtcttcccgcgctatgtggctccggaggcctga

DBGET integrated database retrieval system