KEGG   Rhizobium sp. N731: AMK02_CH04013Help
Entry
AMK02_CH04013     CDS       T04809                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00020  Citrate cycle (TCA cycle)
rhx00310  Lysine degradation
rhx00380  Tryptophan metabolism
rhx01100  Metabolic pathways
rhx01110  Biosynthesis of secondary metabolites
rhx01120  Microbial metabolism in diverse environments
rhx01130  Biosynthesis of antibiotics
rhx01200  Carbon metabolism
Module
rhx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMK02_CH04013 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    AMK02_CH04013 (sucB)
   00380 Tryptophan metabolism
    AMK02_CH04013 (sucB)
Enzymes [BR:rhx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMK02_CH04013 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ANK87532
Position
complement(4071921..4073177)
Genome map
AA seq 418 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPVSGTLSEIV
AAAGETVGLGALLGQIAEGAGAAASAAAAPAAVPAQPAPAAAAQPAAAAAASSSSASVST
MPPAPAAAKMLAESNLSADQIDGSGKRGQVLKGDVIAAVAKGISAPAAVPAAAPVAARGP
STVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIFEKK
HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVVPVIRDA
DQMSIAEIEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAPQSGILG
MHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccgattctggagcttgaa
accgacaaggtgaccatcgaagttcccgcgcctgtctccggcacgctgtcggaaatcgtc
gccgccgccggcgagaccgtcggtctcggtgcactgctcggccagatcgccgaaggtgcc
ggtgctgccgcgtcggctgctgccgcaccggctgccgttcccgcccagccggccccggct
gccgcggcccagccggctgctgctgccgctgcatcctcgtcgagcgcttccgtctccacc
atgccgccggcaccggcggctgcgaagatgctggctgaaagcaatctttccgccgatcag
atcgacggcagcggcaaacgtggccaggtgctgaagggcgatgtcattgccgccgtcgcc
aagggcatttccgctccggcggccgtacccgcagcggcgccggttgcagcgcgcggcccg
tcgacggtcgaggatgcctcgcgcgaagagcgcgtgaagatgacgcgcctgcgccagacg
atcgccaagcgcctcaaggacgcgcagaacaccgccgccatgctcaccacctataacgag
gtggacatgaaggcggtcatggacctgcgcaacaagtacaaggacattttcgagaagaag
cacggcgtcaagctcggcttcatgggcttcttcaccaaggctgtgacgcatgcgctgaag
gaattgccggcggtcaatgccgagatcgacggcaccgacgtcatctacaagaactactgc
catgtcggcatggccgtcggcaccgacaagggcctcgtcgttcctgtcatccgcgatgcc
gaccagatgtcgatcgccgaaatcgagaaggacctcggccgtcttgccaaggcggcgcgt
gacggctcgctctccatggccgacatgcagggcggcaccttcaccattaccaacggcggt
gtttacggctcgctgatgtcctcgccgatcctcaacgcgccgcagtccggcattctcggc
atgcacaagatccaggaacggccggttgccatcggcggccaggtggtcatccgcccgatg
atgtatctggcgctttcctacgatcaccgcatcgtcgacggcaaggaagcagtcaccttc
ctcgtgcgcgtcaaggaaagcctcgaagatccggaacgtctggttctcgatctctaa

DBGET integrated database retrieval system