KEGG   Rhizobium sp. N731: AMK02_PB00089Help
Entry
AMK02_PB00089     CDS       T04809                                 

Gene name
bkdB
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K09699  2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00280  Valine, leucine and isoleucine degradation
rhx00640  Propanoate metabolism
rhx01100  Metabolic pathways
rhx01110  Biosynthesis of secondary metabolites
rhx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMK02_PB00089 (bkdB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMK02_PB00089 (bkdB)
Enzymes [BR:rhx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     AMK02_PB00089 (bkdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ANK88017
Position
pRspN731b:94949..96187
Genome map
AA seq 412 aa AA seqDB search
MGEFIIKMPDVGEGVAEAELVEWHVKPGDPVREDMVIAAVMTDKATVEIPSPVDGTVIWL
AGDIGDRIAVKAPLVRIETAGDAGEASPVQISQAPVAEPVKVEAARPAPAAAAPPALASP
PAEKPLAAPSVRLFARESGVDLRQVQGTGPAGRILREDVEHFLSQGAAPATVKNGLARKT
ATEEIKLTGLRRRIAEKMVLSTSRIPHITYVEEVDMTALEELRATMNSDRREEHPKLTVL
PFLMRALVKAISDQPDVNATFDDDAGIITRHSSVHIGIATQTPAGLTVPVVRHAEARGIW
DCAAEMNRLAEAARSGTATRDELSGSTITISSLGALGGIVSTPVINHPEVAIIGVNKIAT
RPVWDGTQFVPRKMMNLSSSFDHRIIDGWDAATFVQRIRMLLETPALIFIEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaattcatcatcaagatgcccgatgtcggggaaggggtggccgaggccgagctg
gtggaatggcatgtgaagccgggagatcccgtccgcgaggatatggtgatcgccgcggtg
atgaccgacaaggcgacagttgaaattccctctcccgtcgatggcaccgtcatctggctc
gccggcgatatcggagatcgtatcgccgtcaaggcgccgctggtgcggatcgaaacggca
ggcgatgccggcgaggcttcgcctgtacagatctcgcaggcgccggttgcggaaccggtc
aaggtcgaagctgcacggccggctccggctgctgcggccccgccggctctcgcgtcgcct
ccggccgaaaagccgctggcagccccctctgtgcggcttttcgccagggaaagcggcgtc
gatctccggcaagtgcagggcactggacctgccggacgcatcctgcgcgaggatgtcgag
cactttctgtctcagggagcagcgccagcaacggtaaagaatggtctcgccagaaagacc
gcgaccgaggagatcaagctgaccggcctgcgccgccgcatcgccgagaagatggtgctg
tccacctcgcgcattccccacatcacttatgtggaggaagtcgacatgaccgcgctcgag
gagttgcgcgccaccatgaacagcgaccgccgggaagagcacccgaagctgacggtcttg
cccttcctgatgcgggcgctcgtaaaggccatttccgaccagcccgacgttaacgccacc
ttcgacgacgatgccggcatcatcacacgccacagttccgtgcatatcggcatcgccacc
cagacgcccgcgggtctgaccgtgccggtggttcggcacgcggaagcccgcggcatctgg
gattgcgccgccgaaatgaaccggctggcggaagcggcgcgctcgggcacggcgacgcgc
gacgagctttccggctcgaccatcaccatcagctccctcggcgcgcttggcggtatcgtc
tcgacacctgtcatcaaccatcccgaagtggcgatcatcggcgtcaacaagattgccaca
cgcccggtctgggacggcacccaattcgtgccgcgcaagatgatgaacctgtcctccagc
ttcgatcatcgcatcatcgacggttgggatgcggcgacctttgtccagcgcatccgaatg
ctcctcgaaaccccggcgctcattttcatcgaaggctga

DBGET integrated database retrieval system