KEGG   Rhizobium sp. N731: AMK02_PD00015Help
Entry
AMK02_PD00015     CDS       T04809                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00071  Fatty acid degradation
rhx00072  Synthesis and degradation of ketone bodies
rhx00280  Valine, leucine and isoleucine degradation
rhx00310  Lysine degradation
rhx00362  Benzoate degradation
rhx00380  Tryptophan metabolism
rhx00620  Pyruvate metabolism
rhx00630  Glyoxylate and dicarboxylate metabolism
rhx00640  Propanoate metabolism
rhx00650  Butanoate metabolism
rhx00900  Terpenoid backbone biosynthesis
rhx01100  Metabolic pathways
rhx01110  Biosynthesis of secondary metabolites
rhx01120  Microbial metabolism in diverse environments
rhx01130  Biosynthesis of antibiotics
rhx01200  Carbon metabolism
rhx01212  Fatty acid metabolism
rhx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMK02_PD00015 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    AMK02_PD00015 (vraB)
   00640 Propanoate metabolism
    AMK02_PD00015 (vraB)
   00650 Butanoate metabolism
    AMK02_PD00015 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMK02_PD00015 (vraB)
   00072 Synthesis and degradation of ketone bodies
    AMK02_PD00015 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMK02_PD00015 (vraB)
   00310 Lysine degradation
    AMK02_PD00015 (vraB)
   00380 Tryptophan metabolism
    AMK02_PD00015 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMK02_PD00015 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMK02_PD00015 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMK02_PD00015 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhx04147]
    AMK02_PD00015 (vraB)
Enzymes [BR:rhx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMK02_PD00015 (vraB)
Exosome [BR:rhx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMK02_PD00015 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ANK88634
Position
pRspN731d:13642..14841
Genome map
AA seq 399 aa AA seqDB search
MSYAYQPDEDWQPVVVAAYRTPIGRAFGSLSTVAAEDLLAPIIRRIVAETGVAPDAIDDV
LVGNAAGGGGNIGRLAALNAGLPMAVPGVAIDRQCGSGLEAIILAARLIQAKAGACFLAG
GVESVSTAPWRVERPKANCALPRFYGRARFSPETIGDPEMGVAAENVARQFGISRQRQDE
FALRSHRLAVKTAEAGLFRPEIVEIATAGGLVERDECPRPTTSLEALANLKPVFLVNGSV
TAGNACPVNDGACLVLVMSRDMARSLGIEKGLAFIDSAAAGVDPNLLGIGPVASTDKLLQ
RQPHLLLSKIDAIEFNEAFAAQVLASLDQLDISADAVNKEGGAMALGHPFGASGAILVTR
LYSQLIRGDGRRPAATGLAMIGIGGGIGLTALFEAVRLF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctacgcctatcagcctgacgaggattggcagccggtcgtggtcgccgcctaccgc
acgccgatcggccgggccttcggctcgctttcgacggttgcggccgaagatctgcttgcc
ccgatcattcgccggatcgtcgcggaaacgggcgttgcgcccgatgccatcgacgacgtg
ctggtcggcaatgccgccggcggcggcggcaatatcggccggctggcggcgctcaacgcc
ggcctgccgatggccgtccccggtgtcgccatcgatcggcaatgcggttccggcctagaa
gcgatcatcctggccgcccggctgattcaggcgaaggcgggtgcctgtttcctcgccggc
ggcgtcgaaagcgtcagcaccgccccatggcgcgtcgaaaggccgaaagccaattgcgcc
ctgccgcgcttttacggacgcgcgcgcttctcccccgaaacgatcggcgatcccgagatg
ggcgtcgccgccgaaaatgtcgctcgtcaattcggcatctcgcgccagcggcaggatgaa
ttcgccctgcgtagccacaggctggccgtcaagacggccgaggccggcctcttccggccg
gagatcgtcgagatcgccaccgccggcggcttggtggagcgggacgaatgtccgcgcccg
actacctcgcttgaggccctcgcaaacctgaagccggtcttcctcgtcaatggctccgtg
acagcaggcaatgcttgccctgtgaatgacggcgcctgcctggtgctcgtcatgagccgc
gacatggccagaagcctcggcatcgaaaaaggcctcgctttcatcgacagcgccgccgcc
ggcgttgatcccaacctcctcggcatcggcccggtcgcctcgacggataagcttctgcag
cgccagccccacctcttgctctcgaagatcgacgccatcgaattcaatgaggctttcgcg
gcgcaggttctggcgtcgctcgatcagctggatatatcagccgacgcggtcaacaaggag
ggcggcgccatggcgctcggccatcccttcggcgcctccggcgcgatcctggtcacccgg
ctctacagccagctcatccgcggggatggccggaggcccgccgccaccggcctcgccatg
atcggcattggtggcggcatcgggctcactgcgcttttcgaggctgtccgccttttctga

DBGET integrated database retrieval system