KEGG   Rhodoferax koreense: RD110_00335Help
Entry
RD110_00335       CDS       T04721                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00970  Aminoacyl-tRNA biosynthesis
rhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RD110_00335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rhy03029]
    RD110_00335
Enzymes [BR:rhy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RD110_00335
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RD110_00335
Mitochondrial biogenesis [BR:rhy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RD110_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase UBA
Motif
Other DBs
NCBI-ProteinID: APW35853
UniProt: A0A1P8JQ36
Position
75433..76854
Genome map
AA seq 473 aa AA seqDB search
MQDEIHRWTARRLAQEVTAGTLSATEVAEAMCARVARLEPQLNAFADFDPAVPLAAAREV
DTRLAAGEKLPLAGVPFTVKDNLWLGGRPATFGSKVFADFVAPRDAWCVARLRALGAVPL
GVTNCSEFACKGITATPLHGETRNPWDLARTPGGSSGGAVAAVAAGIGPLALATDAGGST
RRPAAHAGLVGMKPTLGRVPNPWGFDDPNHLLSVIGQIGRDVEDVALMLDALTAWEPADT
LSTPAFAVPDAMDTLKQPLRKMRIAWSPQLGCELAVDSDVLATFEAAVDALRRAGWSIER
ADPAWPPEAREYPLIALQQAALAQRFGAVWRQTPEMLDPDIGAQIELGFGITGTRITELL
KLREEFHASFTRFFGEFDALLCPTSPVEAWPLGSLGPSQIGGLPAGPRGHAAFTPIFNYG
GVPALSLPCGTGRQGLPVGLQIAGPRYADALVLQLGWHAEQVLGSGLFSPLMD
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgaaattcatcgctggacggcacggcgcctcgcgcaggaggtcacggccgga
acgctttccgccaccgaggtggccgaggcgatgtgcgcccgcgtggcgcggctggagccg
cagctcaacgcgtttgccgacttcgacccggccgtgccgctggccgccgcgcgcgaggtg
gacacccgcttggccgcgggcgaaaagctgccgctggccggtgtgccgttcacggtgaag
gacaacctgtggctcggcggccggccggccaccttcggctccaaggtgttcgccgacttc
gtggcgccgcgcgatgcctggtgcgtggcgcggctgcgtgcgctgggtgcggtaccgctg
ggcgtgaccaactgttccgaattcgcctgcaagggcatcaccgccacgcccctgcacggc
gagacgcgcaacccctgggatctggcgcgcacgccgggtggctcttcgggcggcgcggtg
gcggcggtggccgcaggcatcggcccgctggcgctggccaccgacgccggtggctcgacg
cgccggccggccgcacacgccggcctggtgggcatgaagccgacgctgggccgcgtgccc
aacccatggggtttcgacgacccgaaccacctgctgtcggtgatcggccagatcggccgc
gacgtggaggatgtggcgctgatgctggacgcactcaccgcctgggagccggccgacacc
ctgtccacacccgcattcgcggtgccggatgccatggacacactcaagcagccgctacgc
aagatgcgcattgcctggtcgccacagctcggctgcgaactggccgtggacagcgacgtg
ctcgccaccttcgaagccgcagtggatgccctgcgccgcgccggctggtccatcgaacgc
gccgacccggcctggccgcccgaggcgcgcgaatacccgctgatcgcgctgcagcaggcc
gcgctggcccagcggtttggcgcggtgtggcgccagacgccggagatgctcgatccggac
atcggcgcgcagatcgaactcggctttggcatcaccggcacgcgcatcacggaattgctg
aagctgcgcgaggaattccacgcgagcttcacacgcttcttcggcgaattcgacgcactg
ctctgcccgaccagcccggtcgaagcctggccgctcggcagcctggggccgagccagatc
ggaggcctgcccgcaggcccgcggggccacgcggcgttcacgccgatcttcaactacggc
ggtgtgccggcgctctccctgccttgcggcaccggccgccagggcttgcccgtggggctg
cagatcgccgggccacgctatgcggatgcactggtgctgcagctcggctggcatgcggag
caggtgctgggcagcggcctgttctcacctttgatggattga

DBGET integrated database retrieval system