KEGG   Rhodoferax koreense: RD110_07610Help
Entry
RD110_07610       CDS       T04721                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00430  Taurine and hypotaurine metabolism
rhy00460  Cyanoamino acid metabolism
rhy00480  Glutathione metabolism
rhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RD110_07610
   00460 Cyanoamino acid metabolism
    RD110_07610
   00480 Glutathione metabolism
    RD110_07610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rhy01002]
    RD110_07610
Enzymes [BR:rhy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     RD110_07610
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     RD110_07610
Peptidases and inhibitors [BR:rhy01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   RD110_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept T4BSS_DotH_IcmK
Motif
Other DBs
NCBI-ProteinID: APW37078
UniProt: A0A1P8JTJ5
Position
complement(1628574..1630424)
Genome map
AA seq 616 aa AA seqDB search
MKPAFTSLPRLGSLACAALLAACASPGHPPAFSYKTPDQPEGSSGYTEKPGWRTHTYAVA
AANPLATDAGAQVLKAGGSAIDAAIAVQMVLALVEPQSSGVAGGAFLVYFNGKDVEAFDG
RETAPAAADERLFLGADGKPLAFYDAVVGGRSVGTPGAVRMLELAHREYGRLPWAQLFQP
AIQLATNGFKVSARLNTLLAGEPHLKKDPVAAAYFYDASGQPWPVGHVLKNPALADVLQR
IATQGSKGLLEGEVAQAIVDKVRHHPANPGQLALTDLSGYQAKKRASLCFDYTAKAAAGA
KDYRICGMPPPSSGTIAVGQILGLLNNTDAARLPLAAGVTGFSGPTPGADWLHLYTEASR
LAFADRGQFVADPDFVQPPGGSWSTLLSPAYLAERARRIDGSPTGQSMKTATPGHPGAMQ
VSYAPSPDQPEYGTSHISIVDAYGHALAMTTTIEDQFGARQMVRGFLLNNELTDFSFAPA
DAAGLPIANRVQPGKRPRSSMSPTLVFDKATGQLVMSGGSPGGAVIIHYTAKTLYGVLNW
GMNAQTAINLPNFGSLNGPTLLEEKRFPPSTVEALRARGAEVREQPMVSGLQAIQKTADG
YFGGADPRREGLVLGD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgctttcaccagcctcccccgtctcggcagcctcgcctgcgccgccctgctg
gccgcctgcgcctcgccaggccatcccccggccttcagctacaagacgccggaccagccc
gagggctcctccggctacaccgagaaacccggctggcgcacccatacgtatgcggtggcc
gcggccaacccgttggccaccgatgccggtgcgcaggtgctcaaggccggtggctcggcc
atcgacgccgccatcgccgtgcagatggttctggccctggtggagccgcagtccagcggc
gtcgccggcggcgcattcctggtgtatttcaacggcaaggacgtcgaggccttcgacggc
cgcgagacggcaccggccgcggccgacgaaaggctgttcctcggcgcggacggcaagccg
ctggccttctatgacgctgtagtcggtggtcgctcggtcggcacgcctggcgcggtgcgc
atgctggagctggcccaccgcgagtacggccgcctgccctgggcgcagttgttccagccg
gcgatccagttggccaccaacggcttcaaggtcagcgcccggctgaacaccctgctcgcc
ggcgagccgcacctgaagaaggatccggtggctgccgcgtatttctacgacgcgagcggc
cagccctggcccgtgggccatgtgctgaagaatccggcgttggccgatgtcctgcagcgc
atcgccacgcagggctccaagggcttgctcgaaggcgaggtggcccaggccatcgtcgac
aaggtgcggcaccatccggccaatcccggccaactcgcgctgaccgacctgtctggctac
caggcgaagaaacgcgcctccctctgcttcgactacacggccaaggcggctgctggcgcg
aaggattaccgcatctgcggcatgccgccgcccagttcgggcaccatcgccgtgggccag
atcctcggcctgttgaacaacaccgatgcggcacgcctgccgctggccgccggcgtgacc
ggcttttccgggccgacccctggcgcggactggctgcacctctacaccgaggcctcgcgc
ctggcgtttgccgatcgtggccagttcgtggccgatcccgatttcgtgcagccccccggc
ggcagttggtccacactgttgagcccggcctacctggcggaacgggccaggcgcatcgac
ggctcacccaccggccagagcatgaagacagccacgccgggccatccgggcgcgatgcag
gtgagctacgcacccagccccgaccaacccgaatacggcacgagccacatcagcatcgtt
gacgcctacggccatgcgctggcgatgaccaccaccatcgaggaccagttcggtgcgcgc
cagatggtgcggggcttcctgctgaacaacgaactcaccgacttcagctttgcgccggcc
gacgccgccggcctgccgatcgccaaccgcgtgcagcccggcaagcgaccacgctcgtcg
atgtcgccgacactggtgttcgacaaggccaccggccagttggtgatgagtgggggcagc
cccggcggtgcggtgatcatccactacacggccaagacgctgtacggcgtgctcaactgg
ggcatgaacgcgcagactgcgatcaacctgcccaacttcggctcgctcaacgggccgacg
ctgctggaggaaaaacgctttccgccttccaccgtggaggccctgcgcgcgcgcggcgcg
gaagtgcgcgagcaacccatggtcagcggcctgcaagccatccagaagaccgccgacggt
tatttcggtggcgccgatccgcgccgcgaaggcttggtgctcggcgactga

DBGET integrated database retrieval system