KEGG   Rhodoferax koreense: RD110_10150Help
Entry
RD110_10150       CDS       T04721                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rhy  Rhodoferax koreense
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RD110_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: APW37505
UniProt: A0A1P8JUU1
Position
2173476..2174486
Genome map
AA seq 336 aa AA seqDB search
MATVQVAVWVVVLLVLLALVFDFMNGFHDAANSIATVVSTGVLKPGQAVVFAAFFNLLAL
FVFHLSVAATVGKGIADPNVINVHVVFGALIGAITWNLITWYYGIPSSSSHALIGGIVGA
VIAKAGTGALVASGIWRTVLFIFVSPLLGFLLGSLMMVLVAWVFRRSTPSRVDRWFRRLQ
LASAGAYSLGHGGNDAQKTIGIIWMLLIATGYASASDAAPPTWTIVSCYTAIAGGTMFGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFMATLLGIPVSTTHTITGAIVGVGSVQRAS
AVRWGVAGNIVWAWILTIPASAFVAAIAYWVSLQLF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgtgcaggtggcagtgtgggtggtggtgttgctggttctgctggcgctggtt
ttcgatttcatgaacggcttccacgacgccgccaattcgattgcgaccgtggtgtcgacc
ggggtgctcaagccgggccaggccgtggtcttcgcggcatttttcaatctgctggccttg
ttcgtctttcatctcagcgtggcagcgacggtaggcaagggcattgccgatccgaatgtg
atcaacgtgcatgtggtgttcggtgcgctcatcggggcgatcacctggaacctcatcacc
tggtattacggcattccgagcagttcctcgcatgcgttgatcggcggcatcgtcggcgcc
gtcatcgccaaggccggcacgggtgcactggtggcctcgggcatctggcgcacggtgctt
ttcatcttcgtctcgccgttgctgggtttcttgcttggctcgttgatgatggtgctcgtg
gcttgggtcttccgccgctccacgccttcgcgcgtggaccgctggttccgcaggctgcag
ctcgcttcggccggtgcctacagcctgggccacggcggcaacgatgcgcagaagaccatc
ggcatcatctggatgctgttgatcgccaccggttatgcgtcggcctccgacgccgcgccg
ccgacgtggaccatcgtgagttgctataccgccatcgccggcggcaccatgttcggcggc
tggcgcatcgtgcgcaccatggggcagaagatcaccaagctcaagcctgtcggggggttc
tgtgcggaaaccggtggggcgttgaccctgttcatggccacgttgctgggcattccagtc
tctaccacccacaccatcaccggcgccatcgtcggggttggctcggtgcagcgggccagc
gcggtgcgctggggagtggcggggaatatcgtctgggcctggattctgacgatccccgcg
tcggcgtttgtggcggcgatcgcctactgggtcagcctgcagctgttctga

DBGET integrated database retrieval system