KEGG   Rhodoferax koreense: RD110_15840Help
Entry
RD110_15840       CDS       T04721                                 

Definition
(GenBank) hypothetical protein
Organism
rhy  Rhodoferax koreense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3268
Motif
Other DBs
NCBI-ProteinID: APW38493
UniProt: A0A1P8JXL3
Position
3417235..3417651
Genome map
AA seq 138 aa AA seqDB search
MKRCDECHDEAHLLRLGQPGYPYQRDYGPMWVCVPCQAWCGCHPGTENALGRLADAPLRK
AKQAAHAAFDPLWQRKMVRDKVKQGQARRAGYAWLAQQMGLTKKETHIGYFDLDQCKRVV
EICTNLKRKEVGQAPKAP
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctgcgatgaatgccacgatgaagcgcacctgctgcgcctgggccagcctggc
tacccctaccagcgcgactacggtccgatgtgggtatgcgtgccgtgccaggcctggtgc
gggtgccatcctggtaccgagaacgccttgggccggcttgccgacgcgccgctacggaag
gccaagcaagccgcgcatgccgcgttcgacccgctctggcagcgaaagatggttcgcgac
aaggtcaagcagggtcaggccaggcgtgccggctacgcctggctggcccagcagatgggc
ctgacgaagaaggaaacccacatcggctatttcgacctcgaccagtgcaagcgcgtggtc
gagatttgcaccaatctgaaacgcaaggaggttggccaagcgccaaaagcaccatga

DBGET integrated database retrieval system