KEGG   Rhodoferax koreense: RD110_18285Help
Entry
RD110_18285       CDS       T04721                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rhy  Rhodoferax koreense
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rhy03009]
    RD110_18285
Enzymes [BR:rhy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     RD110_18285
Ribosome biogenesis [BR:rhy03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RD110_18285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: APW38916
UniProt: A0A1P8JYT1
Position
complement(3950643..3951623)
Genome map
AA seq 326 aa AA seqDB search
MTDAGDAAEEGFEAGLASETRTLLIGEAQHGMRLDRALVDLVPEFSRSYLQQLIESGAVQ
LHGKPAVKASAKVRIGDAGTIELRPTLQSQAFKPEPMVLEVVFEDEHLRVINKPAGLVVH
PAPGNWSGTLLNGLLARDIQATVLPRAGIVHRLDKDTSGLMVVARTRAAMDALVALIAAR
DVSRQYLALAHKPWTGPKQRSVELPIGRDPRNRLRMAAVDLAQHAGKAARTDITLLDNVD
QGCLVLCALHTGRTHQIRVHMAAIGHALVGDVLYGGAPAAGLTRQALHATRLAFVHPVTG
EPLVFHAPLPADLQAALAAWGVSYNA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatgccggcgatgccgcggaggagggcttcgaggccgggctggcctcggaaacc
cgcacactgctgatcggcgaggcccagcacggcatgcggctggaccgcgcgctcgtcgat
ctggtgcccgagttctcgcgcagctacctgcagcagctcatcgaatccggcgccgtgcag
ctgcatgggaagcccgccgtcaaggcctcggccaaggtgcggatcggcgatgccggcacg
atcgagctgcgccccacgctgcagagccaggccttcaagcccgagcccatggtcctggag
gtggtcttcgaggacgagcaccttcgcgtgatcaacaagccggccggcctggtggtgcat
cccgcccccggcaactggagcggtacgctgctcaatgggctgctggcgcgcgacatccag
gccacggtgctgccgcgcgcgggcatcgtgcaccgcctggacaaggacaccagcggcctc
atggtcgtggcccgcacgcgtgccgccatggatgcgctcgtggcgctgattgccgcgcgc
gacgtgagccgccaatacctggcgctggcccacaagccctggacggggcccaagcagcgc
agcgtcgaactgccgatcggccgcgacccgcgcaaccggctgcgcatggccgcggtcgac
ctcgcgcagcacgcgggcaaggccgcgcgcaccgacatcacgctgctggacaacgtggac
cagggctgtctcgtgctgtgcgcgctgcataccggccgcacccaccagatccgcgtgcac
atggcggccattggccatgcgctggtcggcgacgtgctgtatggcggcgcccccgctgcg
ggcctgacacgccaggcgctgcatgccacccggctggctttcgtgcatccggtgacgggg
gagccgctggttttccacgcgccgctgccggccgacctgcaggccgcgctggccgcgtgg
ggtgtcagttacaatgcctga

DBGET integrated database retrieval system