KEGG   Rhodoferax koreense: RD110_22545Help
Entry
RD110_22545       CDS       T04721                                 

Definition
(GenBank) hypothetical protein
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00220  Arginine biosynthesis
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01130  Biosynthesis of antibiotics
rhy01230  Biosynthesis of amino acids
Module
rhy_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RD110_22545
Enzymes [BR:rhy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     RD110_22545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: APW39641
UniProt: A0A1P8K129
Position
4866356..4866844
Genome map
AA seq 162 aa AA seqDB search
MMCARPHIDLHGLPSLSRLLASARGLRNAPARSVRRLALRGSHLGLLTREVDKASAERFC
RAAEALGAHVSQVTPALTDSSLPADIDRLAGVLARLYSGIECQGIAPSLVGRIAAKSGVP
VFAGLATPAHPLAEAVTAMGGEGSDEEKWIWLIQAVLLERIG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgtgcccgtccccatatcgatctccatggcctgcccagcctctcgaggctgctg
gccagcgcgcgtggtctgcgcaatgcaccggctcgctcggtgcgcaggctcgcgctgcgc
gggagccacctgggcttgctgacccgggaagtcgacaaggccagcgccgagcggttctgc
cgcgctgcagaagccctcggcgcccatgtgtcgcaggtcaccccggcgctcacagacagc
agccttccggccgacatcgaccggctcgccggggtcttggctcgcctctatagcggaatc
gagtgccagggcatcgcgccgtcgcttgtcggccgcatcgcggcgaagtcgggtgtgccg
gtgttcgcgggcctggccacgccagcgcacccgctggcggaggccgtcacagccatgggt
ggcgaaggcagcgacgaggagaaatggatctggctgatccaggcggtgctgctcgaacgg
atcggatga

DBGET integrated database retrieval system