KEGG   Rhodoferax koreense: RD110_23215Help
Entry
RD110_23215       CDS       T04721                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00071  Fatty acid degradation
rhy00072  Synthesis and degradation of ketone bodies
rhy00280  Valine, leucine and isoleucine degradation
rhy00310  Lysine degradation
rhy00362  Benzoate degradation
rhy00380  Tryptophan metabolism
rhy00620  Pyruvate metabolism
rhy00630  Glyoxylate and dicarboxylate metabolism
rhy00640  Propanoate metabolism
rhy00650  Butanoate metabolism
rhy00900  Terpenoid backbone biosynthesis
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01120  Microbial metabolism in diverse environments
rhy01130  Biosynthesis of antibiotics
rhy01200  Carbon metabolism
rhy01212  Fatty acid metabolism
rhy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD110_23215
   00630 Glyoxylate and dicarboxylate metabolism
    RD110_23215
   00640 Propanoate metabolism
    RD110_23215
   00650 Butanoate metabolism
    RD110_23215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RD110_23215
   00072 Synthesis and degradation of ketone bodies
    RD110_23215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RD110_23215
   00310 Lysine degradation
    RD110_23215
   00380 Tryptophan metabolism
    RD110_23215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RD110_23215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RD110_23215
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RD110_23215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhy04147]
    RD110_23215
Enzymes [BR:rhy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RD110_23215
Exosome [BR:rhy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD110_23215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ocr
Motif
Other DBs
NCBI-ProteinID: APW39750
UniProt: A0A1P8K160
Position
complement(5020574..5021770)
Genome map
AA seq 398 aa AA seqDB search
MSSKTVKDPVVFVGAARTPMGGFQGDFASLAAHDLGGAAIKAAMARSGLAPELVGEVLFG
NCLMAGQGQAPARQAAFKGGLPQGAGAVTLSKMCGSGMKAAMLAHDMLLAGSFEVMVAGG
MESMTNAPHLLPKGRSGIRIGHGQIFDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFSRE
AQDSFATASVRRAQAATESGAFAQEIVPVAVKGRAGEVLVSIDEGPGKIKLDKIPTLKPA
FKKDGTITAASSSSINDGAAALVMTLASTAERLGARPLARIVGHTTHAQAPNWFATAPVG
AVQKLLAKTGWAVADVDLWEINEAFAVVPMALMAELSLSHEIVNVNGGACALGHPIGASG
ARILVTLIHALQARGLKRGVATLCIGGGEATAMAVELV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaaacagtcaaagacccggtggtattcgtcggcgccgcgcgcacgcccatg
ggcggcttccagggcgatttcgctagcctggccgcgcacgacctcggcggcgccgcgatc
aaggcggcgatggcgcgctcgggcctggcgccggaactcgtcggcgaggtcctgttcggc
aactgcctgatggccggccagggccaggcgccggcgcggcaggccgcgttcaagggcggc
ttgccgcagggcgcgggcgcggtcacgctgtcgaagatgtgcggctccggcatgaaggcc
gcgatgctggcgcacgacatgctgctggccggcagcttcgaggtgatggtggccggcggc
atggagagcatgaccaatgcgccacatctgctgcccaagggccgcagcggcatccgcatc
ggccatggccagatcttcgaccacatgatgctcgacggcctggaagacgcctacgaggcc
gggcgctccatgggcaccttcggcgaggactgcgccgccaaatacagcttcagccgcgag
gcgcaggacagcttcgccaccgccagcgtgcgccgcgcgcaggctgccaccgaatcgggc
gccttcgcccaggaaatcgtgccggtggcggtgaagggccgtgccggcgaggtgctggtg
tccatcgacgaaggcccgggcaagatcaaactcgacaagatccccacgctcaagcccgcg
ttcaagaaggacggcaccatcaccgccgcatcgagctcgtcgatcaacgacggcgccgcc
gcgctggtgatgacattggcttccaccgccgaacgcctcggcgccaggccgctggcccgc
atcgtcggccacaccacccatgcgcaggcgccgaactggttcgccaccgcccccgtcggc
gcggtgcagaaattgctcgccaagaccgggtgggccgtggccgatgtcgacctctgggag
atcaacgaggccttcgccgtggtgccgatggcgctgatggccgagctgtcgctgtcgcac
gagatcgtgaacgtcaacggcggcgcctgcgcgctgggtcacccgatcggcgcgagcggt
gcgcgcatcctggtcaccttgatccacgcgctgcaggccagaggtctgaagcgcggtgtc
gccaccctgtgcatcggcggcggggaggctacggcgatggcggtcgaactggtgtga

DBGET integrated database retrieval system