KEGG   Rhodoferax koreense: RD110_24930Help
Entry
RD110_24930       CDS       T04721                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00360  Phenylalanine metabolism
rhy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rhy00790  Folate biosynthesis
rhy01100  Metabolic pathways
rhy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    RD110_24930
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RD110_24930
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RD110_24930
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     RD110_24930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: APW40044
UniProt: A0A1P8K204
Position
complement(5381144..5382043)
Genome map
AA seq 299 aa AA seqDB search
MLTVEKPAPQKHGLAAGSAPPAGADWTIDQGWKNYTPQEHAVWKTLFERQSRLLPGRACD
AFIEGMGKLPIGAEQIPDFRALSEVLMQRTGWSVVAVPGLVPDEVFFEHLAHRRFPAGHF
IRKPHELDYLEEPDVFHDVFGHVPMLMNPAIADYIQAYGEGGLRAQKLGVLEHLARVYWY
TVEFGLVQQPDGLRIYGAGIASSYTETVFALDDPSPNRIAFDLARVMRTNYRIDDFQETY
FVIDGLSELLELARIDFAPLYAQVAGQPAHEPGTVLPGDRLLARGSGAYAAKKRGLHRP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtcgagaaacccgcaccacagaaacacggcctggcggccggctcggctccg
cctgccggcgctgactggacgatcgaccagggttggaagaactacacgccgcaggagcat
gccgtgtggaagacgctgttcgagcggcaatccaggctgctgccgggccgcgcgtgcgac
gcgttcatcgaaggcatgggcaagctgcccatcggtgccgagcagattcccgatttccgg
gcgttgagcgaggtgctcatgcagcgcaccggctggagcgtggtggccgtgccggggctg
gtgcccgacgaggtgttcttcgagcacctcgcgcaccggcgctttcccgcagggcacttc
atccgcaaaccgcacgagctcgactatctggaggagcccgatgtgttccacgatgtcttc
ggccatgtgccgatgttgatgaacccggcgatcgccgactacatccaggcctatggtgaa
ggtggcttgcgcgcacagaagctgggcgttctggagcacctggcgcgcgtctattggtac
acggtggagttcggcctggtgcagcagcctgacggtttgcgcatctatggcgcgggcatt
gcctcgtcctacacggaaacggtttttgcgctcgacgatccgtcgcccaatcgcatcgcg
ttcgatctcgcgcgcgtgatgcgcaccaactaccgcatcgacgatttccaggaaacctat
ttcgtgatcgatggtctgtctgagttgctcgaactcgcgcgcatcgacttcgcgccgttg
tatgcgcaggtggctggccagccggcccacgaacccggcacggtgttgcctggcgatcgg
ttgctcgcgcgcggcagcggggcttacgccgcgaaaaaacgcggcctacatcgtccgtag

DBGET integrated database retrieval system