KEGG   Rhodoferax koreense: RD110_25590Help
Entry
RD110_25590       CDS       T04721                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00480  Glutathione metabolism
rhy00590  Arachidonic acid metabolism
rhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RD110_25590
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RD110_25590
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RD110_25590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF5046
Motif
Other DBs
NCBI-ProteinID: APW40963
UniProt: A0A1P8K4M4
Position
complement(5536568..5537104)
Genome map
AA seq 178 aa AA seqDB search
MSLCLVGPGAVFAAADAPACPAMLQHTFPRLQDEKPQSLCQYAGKVVLVVNTASFCGFTP
QYKGLEALHAKYQARGLVVLGFPSNDFSQEPAANAQIADFCENTFGVKFPMFGKTTVSGA
GAVPLYKQLAKATGSAPAWNFHKYLLARDGHVVASYGSQTEPDDPKLVNELEKQLKLK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtccctttgtcttgtggggccgggcgccgtgtttgccgcagccgatgcgccggcctgc
ccggcgatgctgcagcacaccttcccgcggctgcaggacgaaaagccgcagtcgctgtgc
cagtacgcgggaaaggtggtgctggttgtgaacaccgccagcttctgcggcttcaccccg
cagtacaaggggctggaggcgctgcatgccaagtaccaggcgcgcggcctggtggtgctc
ggtttcccgtcgaacgacttctcgcaggagcccgccgccaacgcgcagatcgccgacttc
tgcgaaaacaccttcggcgtgaagtttccgatgttcggcaagaccacggtctcgggcgcc
ggggcggtgccgctgtacaagcagctggcgaaggccaccggcagcgcgccggcgtggaat
ttccacaagtacctcctggcgcgcgacggccacgtggtggccagctacggcagccagacc
gagcccgacgatccgaagctcgtgaatgagctcgaaaagcagctgaaattgaaataa

DBGET integrated database retrieval system