KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_12660Help
Entry
RHPLAN_12660      CDS       T04290                                 

Definition
(GenBank) Pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00010  Glycolysis / Gluconeogenesis
rhz01100  Metabolic pathways
rhz01110  Biosynthesis of secondary metabolites
rhz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHPLAN_12660
Enzymes [BR:rhz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     RHPLAN_12660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AMN39723
UniProt: A0A127EN88
Position
complement(1475176..1477011)
Genome map
AA seq 611 aa AA seqDB search
MTIDTNAAMPSEHTHLDAPTRQRPNITKAPSVRSPIVGAETRPVAKSDTAVTYTVGSYLA
ARLSQIGLKHHFAVAGDYTLVLLDQLLTNKDRKQVYCSNELNCGFSAEGYARAHGVAAAV
VTFSVGALSAFDALGGAYAENLPVILVSGAPNTNDRAADHLLHHTLGTHDFMYQLEMAKK
ITCAAVSITFAAEAPEKIDYAIRMALREKKPAYIEIACNLAAAPCAAPGPISAVIDREPS
DSESLNAAVTAAADFLRSKKKPVILIGSKLRAAGAEKEAIELADALGCSVAVMAAAKSFF
PEDHPQFIGIYWGEISSPGAQSVVDWSDGVVCVGALFNDYSTVGWTAMPGGPTVLTADPN
RVHLDGREFGRVHLSDFLPALARKVEKRDATMIEWACVRTEPFPEDAAKPDAKLIRAELI
RQIRPLVTANATVIAETGDSWFNGMKLKLPRGARFEIEMQWGHIGWSVPAAFGYAVGAPD
RRIIALIGDGAFQLTAQEVAQMIRLKLPVIIFLMNNHGCTIEVEIHDGPYNNVKNWDYAG
LIKVFNAEDGQGSGLRATNGGELADAIKLALANHDGPTLIECIIDRDDCTSDLISWGHLV
AKANGRPPSPQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgataccaatgcagcgatgccgtccgaacacacgcatctcgatgccccgacc
aggcaacgtccgaacataacgaaggcgccttccgtccgatctccgatcgttggcgccgag
acgcgacccgtagccaagagtgacacggccgtgacttatacagtgggcagctatctcgcg
gctcgcctctctcaaatcggcctaaagcatcattttgccgttgccggcgactataccctc
gtcctgctggaccagcttctgacgaacaaggataggaagcaggtttactgctccaatgag
ttgaactgcggattcagcgcggagggatatgcacgcgcacatggtgtcgctgccgcggtc
gtgaccttcagtgtcggcgcgctctcggccttcgacgcgcttggcggcgcctacgccgag
aacctgccggtcatcctggtgtctggcgcgcctaacactaacgaccgggcggcggatcat
ctgcttcaccatacgctcgggacgcacgatttcatgtatcagctcgagatggcaaaaaag
atcacctgcgccgcggtgtcgatcacttttgcggccgaagcgcctgagaagatcgactat
gcaatccgcatggcgctgcgcgaaaagaagccggcctacatcgagatcgcatgcaacctc
gctgcagctccctgcgcagcaccagggccgatcagtgcagtcatcgatcgcgagccaagc
gattccgagtcacttaatgcggcagtcacagctgcagcagattttcttcgcagcaagaaa
aagccggtgattctgatcggaagcaagttgcgcgctgcgggggctgagaaagaggcgatc
gaacttgccgatgccctcggctgttccgtcgcggtcatggctgcggccaagagcttcttt
ccggaggatcatccacagttcatcggcatctattggggcgagatcagctctcccggcgcg
caatccgttgtcgattggtcggatggcgtggtctgcgttggtgcactcttcaatgattat
tcgacggtcggttggaccgcgatgccaggcggtccaaccgtgctgactgcggacccgaac
cgggtccatctggacgggcgcgaattcggccgggttcacttgagcgatttcctgcctgcc
ctcgcccgcaaggtcgagaagcgcgatgccacgatgattgaatgggcttgcgtccgaact
gagcctttccccgaagacgctgccaagcccgatgcaaagctcatacgagccgaattgatt
cggcaaattcgtccccttgtgaccgccaacgccacggtcatcgctgaaacaggcgattct
tggttcaatggcatgaagctgaagctgccgaggggcgcgcgcttcgagatcgagatgcaa
tggggccatatcggatggtcggtgccggcagccttcgggtacgccgtgggcgcgcccgat
cggaggatcattgccctcatcggcgatggcgccttccagcttacagcgcaggaggtggcg
cagatgatccggctgaagcttccggtcatcatcttcctgatgaacaatcatggatgcacg
atcgaggtcgagatccatgatggtccttataacaacgtcaagaattgggactatgccggg
ctgatcaaggtgttcaacgccgaggacgggcaaggcagcggcctgcgcgccaccaatggc
ggagaacttgccgacgctatcaagctcgcgctcgccaaccacgatgggccgacgctgatc
gaatgcatcatcgatcgcgacgattgcacgtccgaccttatttcctggggccatctggtc
gcgaaggccaacggtaggccaccgagcccgcagtag

DBGET integrated database retrieval system