KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_36830Help
Entry
RHPLAN_36830      CDS       T04290                                 

Definition
(GenBank) ThiH/PfpI family amidotransferase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RHPLAN_36830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rhz01002]
    RHPLAN_36830
Enzymes [BR:rhz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     RHPLAN_36830
Peptidases [BR:rhz01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   RHPLAN_36830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AMN42115
UniProt: A0A127EXS0
Position
4291251..4291946
Genome map
AA seq 231 aa AA seqDB search
MAERLIGMLIFPRLTQLDMTGPYEVLARVPNTKVHLVAKSLAPVRTDRGMEIVPTITLDD
CPQLDLIMVPGGPGQQDLMEDHTVLEFLQKQARGARYVTSVCTGSLVLGAAGLLKGKRAT
CHWAAIDHLKLLGAIPVSERVVIDGNVITGAGVASGIDFALRVAAVLEGEEVARQIQLQI
EYDPAPPFNSGSPKTAPAEITALLRNRLATLNEQRREVAARVGKKLGVPQA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacggctgattggcatgctgatcttcccaaggctcacccagctcgacatgacc
gggccgtatgaggtgctggcgcgggtgccgaacaccaaggtgcatctcgtggcgaagagt
ctcgcgccggtgaggaccgaccgcggcatggagatcgtgccaaccatcacgctcgacgat
tgcccgcagctcgatctgatcatggtgccgggcgggcccggccagcaggacttgatggaa
gaccacacggtcctcgagttcctgcagaagcaggcgcgcggcgccagatacgtcacctcg
gtctgcacgggctcgctggttcttggcgctgcgggcttgctgaaaggcaagcgcgccacc
tgccactgggccgcaatcgaccatctgaagcttcttggcgctattccggtgagcgagcgc
gtggtgatcgacggcaatgtcattaccggcgcgggtgtggcctcaggcatcgatttcgcg
ctcagggttgcggccgtgctcgaaggcgaagaggtcgcgcggcagatccaacttcagatc
gagtacgatccggctccgccgttcaactcgggctcgccgaagaccgcgcctgcggagatc
accgcgctgctgcgcaaccgcctcgccacgctgaatgaacagcgccgcgaggtcgcggcc
cgcgtcggcaagaagctcggtgtgccgcaagcgtaa

DBGET integrated database retrieval system