KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_43440Help
Entry
RHPLAN_43440      CDS       T04290                                 

Definition
(GenBank) Haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00361  Chlorocyclohexane and chlorobenzene degradation
rhz00625  Chloroalkane and chloroalkene degradation
rhz01100  Metabolic pathways
rhz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHPLAN_43440
   00361 Chlorocyclohexane and chlorobenzene degradation
    RHPLAN_43440
Enzymes [BR:rhz01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     RHPLAN_43440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AMN42773
UniProt: A0A127EX12
Position
5006664..5007344
Genome map
AA seq 226 aa AA seqDB search
MAALPLIVFDVNETLLDLATMEPIFERIFGEKSAMRLWFANFIMYSAALTVAGCYVPFTD
IGAAVMKMLADTRGIRIGDTDKKELTDKFSTMPPHPEVPAALRRLRDAGFRLFTLTDNLL
EVQTRQLEHGGIVDLFERRFSADGVKHHKPSREAYAYVEKELGAKPSEFCLIACHTWDTL
GAVAAGWEAALIKRVGNDVLGVGPQPQIIGNDLNDVARQLIARHGT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctccccctgatcgtcttcgacgtcaacgaaacactgctcgatcttgcaacg
atggagcctatcttcgagcgcatcttcggcgagaaaagcgcgatgcgcttgtggtttgcc
aacttcatcatgtattcggcggcgctgaccgtggccggctgctacgtgcccttcaccgat
atcggagccgcggtgatgaaaatgctggcggacacacgcggcatcagaatcggagacacg
gacaagaaggagctgacggataaattctcgacgatgccgccgcatcccgaggtgccggcg
gcgcttcgcaggctgcgtgatgctggtttccgcctcttcaccctcaccgacaatctgctg
gaagtgcaaacccgccagctcgagcatggcggcatcgtcgatctgttcgaacggcgtttc
agcgcggatggcgtaaagcaccacaagccgtcgcgtgaggcttacgcttacgtcgagaaa
gaactcggagccaagccttcggagttctgcctcatcgcctgccacacctgggacaccctg
ggcgccgtcgcggcgggctgggaggctgcgctgatcaaacgcgtcggcaacgatgtcctg
ggcgtgggcccgcagccacagattatcggcaacgacctcaatgacgttgcccggcaactc
atcgcgcgacacggaacgtag

DBGET integrated database retrieval system