KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_55000Help
Entry
RHPLAN_55000      CDS       T04290                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00860  Porphyrin and chlorophyll metabolism
rhz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHPLAN_55000
Enzymes [BR:rhz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     RHPLAN_55000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA
Motif
Other DBs
NCBI-ProteinID: AMN43916
UniProt: A0A127F0C9
Position
6331190..6332647
Genome map
AA seq 485 aa AA seqDB search
MTARAIMFQGTGSDVGKSLLVAGLARAYTKRGLKVRPFKPQNMSNNAAVAFDGGEIGRAQ
ALQARAAGVQPSVHMNPILLKPQSQVGSQVVVQGKVYATAKAAEYMMMKQKLLPHVLDSY
ERLKADADLVLVEGAGSASEINLRRYDIANMGFARAANVPVVVVGDIDRGGVIASLVGTK
AVLDPDDAATVVGFIINKFRGDPSLFIPGKEAIVQATGWPALGFVPYFSEARNLPAEDAL
ALDHAPVRRPGAKLKIAVLILPQIANFDDLDPLEVEPHVGLVRVHPGTAIPGDTDLVILP
GSKTTIAGLNALRAAGFDIDIAAHVRRGGTVIGLCGGYQMLGRTVADPHGVEGPAGTAQG
LGLLDVETVLTSEKTLTHANGTTSDGMPFSGYEMHMGATQGPDCARPFATIDGAPEGAVS
ANGRVIGTYVHGLFADDRQRSAWLQRLGAGPTNVAYEELVESTLDRLAKHLTTFVDLDRL
LSLAR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcgcgcgatcatgttccagggcaccggctccgatgtcggcaagtcgctgctg
gtcgcgggcctcgcgcgggcttacaccaaacgcggcctgaaggtgcggccgttcaagccg
cagaacatgtcgaacaacgccgcggttgcctttgacggcggcgagatcggccgggcgcaa
gcgctgcaggcccgcgccgcgggcgtgcagccgagcgtgcacatgaatccgatcctgctg
aagccgcagagccaggtcggctctcaggtggtggtgcagggcaaggtctacgccaccgcc
aaggccgccgaatacatgatgatgaagcagaagctgctgcctcatgtgctcgacagctac
gagcggctgaaggccgatgccgatctggtattggtcgaaggcgcaggctccgcgtcggag
atcaacctgcgccgctacgacatcgccaacatgggcttcgcccgtgccgcgaacgtgcct
gtggtcgtggtcggcgacatcgatcgcggcggcgtgatcgcgagcctggtcggcaccaag
gcggtgctcgatcctgacgatgccgcgacggtggtgggcttcatcatcaacaaattccgc
ggcgatccgagcctgttcattccgggcaaggaggcgatcgtccaggcgaccggctggccg
gcgctgggcttcgtgccgtatttttcagaggcgcggaatctgccggccgaggatgcgctg
gcgctcgatcatgcaccggtccggcgtccgggcgccaagctcaagatcgcggtgttgatc
ctgccgcagatcgccaatttcgacgatctcgatccgctggaagtggagccccatgtcggt
ctcgttcgcgtgcatccgggcacggccattccgggcgataccgacttggtgatcctgccc
ggctcgaagaccacgattgcggggctcaacgcgctccgcgccgcgggtttcgatatcgac
atcgcagcacacgtgcggcgtggcggcacggtgatcggactttgcggcggctaccagatg
ctcggccgcacggtcgccgatcctcatggcgtcgaaggtcccgcgggcactgcgcagggg
ctcgggctgttggatgtcgaaaccgtgctgacctctgaaaaaacgctgacccatgccaac
ggcacgaccagcgacggcatgccgttttccggctacgagatgcacatgggcgcgacccag
gggccggactgcgcgcggcctttcgcgaccatcgatggcgcgccggaaggcgcggtttcg
gccaacggccgcgtgatcggcacttatgtgcacgggctgttcgccgacgaccgccagcgc
tcggcgtggctgcaacggctcggcgcaggcccgacaaatgttgcatacgaagagttggtt
gaatcgacgctggaccggctggccaagcatctcaccacgttcgtcgatctcgatcgcctg
ctcagcttagcgcggtga

DBGET integrated database retrieval system