KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_61190Help
Entry
RHPLAN_61190      CDS       T04290                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00071  Fatty acid degradation
rhz00072  Synthesis and degradation of ketone bodies
rhz00280  Valine, leucine and isoleucine degradation
rhz00310  Lysine degradation
rhz00362  Benzoate degradation
rhz00380  Tryptophan metabolism
rhz00620  Pyruvate metabolism
rhz00630  Glyoxylate and dicarboxylate metabolism
rhz00640  Propanoate metabolism
rhz00650  Butanoate metabolism
rhz00900  Terpenoid backbone biosynthesis
rhz01100  Metabolic pathways
rhz01110  Biosynthesis of secondary metabolites
rhz01120  Microbial metabolism in diverse environments
rhz01130  Biosynthesis of antibiotics
rhz01200  Carbon metabolism
rhz01212  Fatty acid metabolism
rhz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHPLAN_61190
   00630 Glyoxylate and dicarboxylate metabolism
    RHPLAN_61190
   00640 Propanoate metabolism
    RHPLAN_61190
   00650 Butanoate metabolism
    RHPLAN_61190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHPLAN_61190
   00072 Synthesis and degradation of ketone bodies
    RHPLAN_61190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHPLAN_61190
   00310 Lysine degradation
    RHPLAN_61190
   00380 Tryptophan metabolism
    RHPLAN_61190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHPLAN_61190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHPLAN_61190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHPLAN_61190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhz04147]
    RHPLAN_61190
Enzymes [BR:rhz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHPLAN_61190
Exosome [BR:rhz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHPLAN_61190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMN44530
UniProt: A0A127F4R5
Position
complement(7049215..7050381)
Genome map
AA seq 388 aa AA seqDB search
MTGCIVGWAHTPFGRLDGETVESLVVKAANGALKDAGIEAKDVDEIVLGHFNAGFSAQDF
TASLVLQASPDLRFKRALRVENACATGSAAVHLGLRSLAAKSARIVLVVGVEQMTTTPGP
EIGKNLLKASYVREEADIEGGFAGIFGKIAGLYFQRWGDQSDALAMIAAKNHKNGVGNPY
AQLRKDLGYDFCRTVSDKNPFVAGPLKRTDCSLVSDGAAAVVLADVETALQLKKAVAFRA
TAHVQDFLPMSKRDILKFEGCTLAWQRALKDAGITLDDLSLVETHDCFTVAELIEYEAMG
LVPEGQGARAIKEGWTQKGGKLPVNPSGGLKAKGHPIGATGVSMHALCAMQLTGTAGDIQ
VRDAKLAGIFNMGGAAVANYVSVLERIK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctgcatcgtgggttgggcgcatacgccgttcggcagactcgatggcgaaacc
gtcgaaagcctggtggtcaaggccgccaatggcgcgctcaaggacgccgggatcgaagca
aaagatgtggacgagatcgtgctcggccattttaacgcggggttctcggcgcaggatttc
acagcctcgctggtgctgcaggcgtcgcccgatctgcgtttcaagcgtgccttgcgcgtg
gagaatgcctgcgccaccggttcagccgccgttcatcttggcttgcggtcgcttgccgcc
aagtcggcacgcatcgtccttgtggtcggcgtcgaacagatgaccacgacgcccggtcct
gagatcggcaaaaacctgttgaaagcgtcctacgtgcgcgaggaggccgacatcgaaggc
ggcttcgccggcattttcggcaaaattgcgggactctatttccaacgctggggcgatcag
tccgacgcgctggcgatgattgccgcgaagaaccacaagaacggcgtcggcaatccttac
gcgcagctgcgcaaggatctcggttacgacttctgccgcaccgtgagcgacaagaacccg
tttgtcgcggggccgttgaagcgcaccgactgttcgctggtgtccgacggcgcggccgcc
gtggtgctggccgatgtcgagaccgcgctgcagctgaagaaggcggtggcgtttcgtgcc
acggcgcacgtgcaggacttcctgccgatgtcgaagcgcgacatcctgaagttcgaaggc
tgtacgcttgcctggcagcgcgcactgaaggatgccggcatcacgctcgacgatctgtcg
ctggtcgagacacacgactgcttcacggttgccgagctgatcgaatacgaagcgatgggc
cttgtgccggaagggcagggcgcgcgcgccatcaaggaaggctggacccagaagggcggc
aagctgccggtcaatccgtcgggcggattgaaagccaagggccatccgatcggcgcgaca
ggggtgtcgatgcatgcgctctgcgccatgcagttgacgggcacggcgggcgacatccag
gtgcgcgacgccaagctcgccggcattttcaacatgggcggcgcggccgtggcgaattac
gtgagcgtgctggagcggatcaagtag

DBGET integrated database retrieval system