KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_67530Help
Entry
RHPLAN_67530      CDS       T04290                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00010  Glycolysis / Gluconeogenesis
rhz00020  Citrate cycle (TCA cycle)
rhz00620  Pyruvate metabolism
rhz01100  Metabolic pathways
rhz01110  Biosynthesis of secondary metabolites
rhz01120  Microbial metabolism in diverse environments
rhz01130  Biosynthesis of antibiotics
rhz01200  Carbon metabolism
Module
rhz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHPLAN_67530
   00020 Citrate cycle (TCA cycle)
    RHPLAN_67530
   00620 Pyruvate metabolism
    RHPLAN_67530
Enzymes [BR:rhz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     RHPLAN_67530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AMN45159
UniProt: A0A127F6M0
Position
complement(7787876..7789528)
Genome map
AA seq 550 aa AA seqDB search
MRPGRREEEFSVKETGLRNAAFGADKFGLKDLGAVHWNLTEAPLYEHAIRNGEATIVAGG
ALGAETGHHTGRSPKDKHTKVDQLTESTVWWDGNRKQSQEHFDNMLQDFLAHAKGKTLYA
QDLYGGADPKYRIKVRVYTEYAWHSLFIRQLLIRPDRAELASFMADMTIIDMPSFKPDHK
RHGGREGSDTQVAIDFTRKIVLICGSSYAGEMKKSVFTTLNFYLPAQGVMPMHCSANVGK
DGDSALFFGLSGTGKTTLSADPNRTLIGDDETGWSPDGIFNFEGGCYAKCIKLSQEAEPM
IWDATNRFGAVLENVVYDAETRIPDYNSDKLTENTRSAYPLDFIPNASRSGMAGHPKNII
FLTADAYGVMPPIAKLTPAQAMYHFLSGYTAKVAGTEKGLVGVEPEFSTCFGAPFLPRPP
AEYGRLLRDYIAKYKVDCWLVNSGWTGGIYGVGSRMPIKVTRALVTGALDGSLKNATFRT
DKYFGFAVPTAVPGIDTKILNPDQTWADPKAFDETARKLVGMFQKNFAKYEKTVDAEVRA
AAPEVRMAAE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccggaaggcgtgaggaggaattttccgtgaaagaaactggtctgcgtaacgcc
gcctttggcgccgacaaattcggtctcaaagacctcggtgcggtccattggaatctgacc
gaagcgccgctctatgagcacgcgatccggaacggcgaggcgaccatcgtggcgggcggc
gcgctcggcgccgagaccggccatcacaccggccgttcgccgaaggacaagcacaccaag
gtcgaccagctcaccgaaagcactgtttggtgggacggcaaccgcaagcagagccaggag
cacttcgacaacatgctccaggacttcctggcgcatgccaaaggcaagacgctttacgcg
caggacctctacggcggcgccgatccgaagtaccggatcaaggtgcgcgtctacaccgaa
tacgcctggcactcgctgttcatccgccagctgctgatccgtccggatcgtgccgagctt
gcctcgttcatggcggacatgaccatcatcgacatgccgtcgttcaagccggaccataag
cgtcacggcggccgcgaaggctcggatacccaggtggcgatcgacttcacccgcaagatc
gtgctgatctgcggctcgtcctatgcgggcgagatgaagaagtcggtgttcacgacgctg
aacttctatctgccggcccagggcgtgatgccgatgcactgctcggccaacgtcggcaag
gacggcgacagcgcgctgttcttcggcctctccggcaccggcaagaccacgctgtcggcc
gatccgaaccgcacgctgatcggcgacgacgagaccggctggtcgccggacggcatcttc
aacttcgagggcggctgctacgccaagtgcatcaagctctcgcaggaagcggagccgatg
atctgggacgccaccaaccgcttcggcgccgtgctcgagaacgtcgtatacgatgcggag
acccgcatcccggattacaacagcgacaagctgaccgagaacacgcgttccgcctatccg
ctcgacttcatcccgaacgcgtcgcgctcgggcatggccgggcatccgaagaacatcatc
ttcctcaccgccgacgcttatggcgtgatgccgccgattgcgaagctcacgcccgcccag
gcgatgtatcacttcctctccggctacaccgcgaaggtcgcgggcaccgaaaagggtctt
gtcggcgtcgagccggaattctcgacctgcttcggcgcgccgttcctgccgcgtccgccg
gcggagtacggtcggctgctgcgcgactacatcgccaagtacaaggtcgattgctggctg
gtgaactccggctggaccggcggcatctacggcgtcggctcccgcatgccgatcaaggtg
acgcgtgcgctggtgaccggcgcgctcgacggctcgctgaagaacgcgacgttccgcacc
gacaagtatttcggcttcgcggttccgaccgcagtgccgggcatcgacaccaagatcctc
aacccggatcagacctgggccgatccgaaggcgttcgatgaaacggcccgcaagctcgtc
ggcatgttccagaagaactttgccaagtacgagaagaccgtggatgcggaagtgcgcgcc
gcggcgcccgaggttcggatggctgcggaataa

DBGET integrated database retrieval system