KEGG   Rathayibacter iranicus: C7V51_09410Help
Entry
C7V51_09410       CDS       T05878                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ria  Rathayibacter iranicus
Pathway
ria03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ria00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C7V51_09410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ria03011]
    C7V51_09410
Ribosome [BR:ria03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C7V51_09410
  Bacteria
    C7V51_09410
  Archaea
    C7V51_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AZZ56073
Position
complement(2019255..2019620)
Genome map
AA seq 121 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVNLIRGKQAQEALAILKFAPQGASEPVYKLVASAMANAR
VKADASNEYLDDQDLFVSRAFVDEGTTLKRFQPRAQGRAFRINKRTSHITVVLATPEEGT
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgacacatccgcgtcaccccccagaaggctcgccgt
gtcgtgaacctgatccgcggaaagcaggctcaggaggcactcgccatcttgaagttcgcg
ccgcagggtgcgtccgagcccgtctacaagctcgtcgcctcggcgatggcgaacgctcgc
gtcaaggctgatgcctcaaacgagtacctcgacgaccaggacctgttcgtgtcccgcgcc
ttcgtcgatgagggaaccaccctcaagcgattccagccccgtgctcagggtcgtgccttc
cgcatcaacaagcgcaccagccacatcaccgtcgtgctggccactcctgaggaggggacc
aagtaa

DBGET integrated database retrieval system