KEGG   Rathayibacter iranicus: C7V51_13505Help
Entry
C7V51_13505       CDS       T05878                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ria  Rathayibacter iranicus
Pathway
ria00480  Glutathione metabolism
ria00590  Arachidonic acid metabolism
ria01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ria00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C7V51_13505
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C7V51_13505
Enzymes [BR:ria01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C7V51_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: AZZ56775
Position
2880144..2880623
Genome map
AA seq 159 aa AA seqDB search
MTIADIPLTTIDGTASTLADYPPVRLIVNVASRCGLAPQYEKLEALQKSYGDRGFTVLGF
PSNQFLQELSDEDKIKEYCSTTWGVTFPMFEKVRVNGRAAHPLYAELTKTEDENGKAGRV
KWNFEKFLVTADGTVHRFRPTVEPDDPRIVELIEESLPH
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattgccgacattccgctcaccacgatcgatggcaccgcgtcgaccctcgccgac
tatccgccggtgcggctaatcgtgaatgtcgcctcgcggtgcggcctcgctccgcagtat
gaaaagctcgaggccctgcagaagtcttacggcgaccgcggattcacggtgctgggcttt
ccgagcaatcagtttttgcaggagctgagcgacgaggacaagatcaaagaatactgctcc
accacctggggagtcacgttccccatgttcgagaaggtgcgcgtgaacggccgtgccgcg
catccgctttacgcagagttgacgaagaccgaggacgagaacggcaaggccggccgggtg
aagtggaacttcgagaagttcctcgttactgccgacggcacggtccaccggttccgaccg
acggtcgaacccgacgacccgcggatcgtcgagctgatcgaggagtcgctcccccactag

DBGET integrated database retrieval system