KEGG   Rickettsia sp. MEAM1 (Bemisia tabaci): BA173_03530Help
Entry
BA173_03530       CDS       T05695                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ric  Rickettsia sp. MEAM1 (Bemisia tabaci)
Pathway
ric00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ric00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BA173_03530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ric01007]
    BA173_03530
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ric03016]
    BA173_03530
   03029 Mitochondrial biogenesis [BR:ric03029]
    BA173_03530
Enzymes [BR:ric01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BA173_03530
Amino acid related enzymes [BR:ric01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BA173_03530
Transfer RNA biogenesis [BR:ric03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BA173_03530
 Prokaryotic type
   Other AARSs
    BA173_03530
Mitochondrial biogenesis [BR:ric03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BA173_03530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: ASX27920
UniProt: A0A249E3M0
Position
689896..691704
Genome map
AA seq 602 aa AA seqDB search
MHKYRTHNCNELKISDVGTEVKLSGWVHRRRDHGNLVFVDLRDHYGITQIVFTDQNPQLM
DDASRLRYESVVTVVGKVVARSEETINNTLPTGHIEVLASEFIIESAADTLPFVINTEKD
APEDSRLKHRFLDLRREKLHNNIMLRSQIISYIRQLMTARGFTEFQTPILTASSPEGARD
FLVPSRLHLGKFYALPQAPQQFKQLLMVSGFDRYFQIAPCFRDEDARADRSPGEFYQLDI
EMSFVTQEDIFSTIEPVMYELFTKFTDKKVSEAPFIRIPYNESMLKYGSDKPDLRNPIVI
TDVTEIFRDSDFTIFRENIKKGSIVRAIPAPSATSQPRSFFDKMIEFAISEGAGGLGYIQ
FSESGEAKGPVAKFLSTQQLEDLKATANISNGDAVFFASDKKDKAAKLAGKVRIKLADEL
DLLEKDCFKFCWITDFPFYELNEETGKIDFSHNPFSMPQGGLEALENAKTTEELLELTAY
QYDIVCNGIELSSGAVRNHKLEIMYKAFAIAGYSEEEVDKRFGGMIRAFKFGAPPHGGIA
PGIDRIVMLLAEATNIREIIAFPLNQQAEDLLMNAPNYVEDKALKELSVMLSPSARKNAE
KE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatatagaactcataattgtaacgaattaaaaatttccgatgttgggactgaa
gtaaaactgtctggttgggtacatagaagaagagatcatggcaatctagtttttgtagat
ttacgtgatcattatggcataacacaaatcgtgtttaccgaccaaaatccgcagcttatg
gacgatgctagccgtttacgttatgagtcagttgttacagtagttgggaaagtagtagca
agatcagaagagactattaataacacacttcctactggtcatatagaagttttagccagt
gaatttattattgaatcagcggctgatactctgccgtttgtgattaatacggaaaaagac
gcacctgaagactcaaggcttaaacatcgctttttagatttaagacgtgagaagttgcat
aataatataatgcttcgttcacaaattatttcttacattcgtcagctaatgactgcaaga
ggctttaccgaatttcaaacacctattctaactgctagctcacctgaaggagctagggat
ttcttagtcccaagcagattacatctgggcaagttttatgcattaccgcaagcaccacaa
caatttaagcagctattgatggtatcgggatttgatcgttatttccaaattgctccgtgt
tttcgtgatgaagacgcaagagcagataggtcaccaggcgagttttatcagctagatatc
gaaatgtcgtttgttacgcaagaagatatattcagcacaatcgagccggttatgtatgag
ctatttacaaaatttacagataagaaagtgtcagaagcaccctttatccgtattccatat
aacgaatctatgctgaaatatggttctgataagcctgatttacgaaaccctattgtaatt
actgatgtaacggaaatttttagagattcagactttactatttttagggaaaatatcaaa
aaaggtagtattgtccgagcaattcctgcaccgagtgctacaagtcagcctcgtagcttc
ttcgataaaatgatagaattcgcaatatcggagggagctggaggacttggctatattcag
tttagcgaaagcggtgaagcaaaaggaccggtcgcaaaattcttaagcactcagcaatta
gaagatttgaaggctactgctaatattagcaatggcgatgcggtatttttcgctagcgat
aaaaaagataaagcagccaaacttgccggtaaggtaagaattaaacttgctgatgagcta
gatttacttgaaaaggattgctttaaattctgctggattaccgattttccattctatgag
ctaaacgaagaaaccggtaaaattgattttagccataatccattttctatgcctcagggt
gggttagaagctcttgagaacgctaaaactactgaagagctgttagagcttaccgcatat
cagtatgatattgtttgtaatggcatagagctttctagcggtgctgttaggaatcataag
ctggaaataatgtataaggcatttgctatagctggttatagtgaagaggaagtggataaa
cgatttggtggtatgattagagcgtttaaatttggagcaccaccacatggcggcatagct
ccaggtatagaccgaatcgttatgttacttgcggaagctactaatataagagaaataatc
gctttcccattaaatcagcaagctgaagatttattaatgaacgctccgaattatgttgaa
gataaggcgttaaaagaactaagtgtcatgctctccccatctgctagaaagaatgcggaa
aaagagtaa

DBGET integrated database retrieval system