KEGG   Roseovarius indicus: RIdsm_03934Help
Entry
RIdsm_03934       CDS       T06222                                 

Gene name
fadJ_3
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rid  Roseovarius indicus
Pathway
rid00071  Fatty acid degradation
rid00280  Valine, leucine and isoleucine degradation
rid00281  Geraniol degradation
rid00310  Lysine degradation
rid00362  Benzoate degradation
rid00380  Tryptophan metabolism
rid00410  beta-Alanine metabolism
rid00640  Propanoate metabolism
rid00650  Butanoate metabolism
rid00903  Limonene and pinene degradation
rid00930  Caprolactam degradation
rid01100  Metabolic pathways
rid01110  Biosynthesis of secondary metabolites
rid01120  Microbial metabolism in diverse environments
rid01200  Carbon metabolism
rid01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RIdsm_03934 (fadJ_3)
   00650 Butanoate metabolism
    RIdsm_03934 (fadJ_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RIdsm_03934 (fadJ_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RIdsm_03934 (fadJ_3)
   00310 Lysine degradation
    RIdsm_03934 (fadJ_3)
   00380 Tryptophan metabolism
    RIdsm_03934 (fadJ_3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RIdsm_03934 (fadJ_3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RIdsm_03934 (fadJ_3)
   00281 Geraniol degradation
    RIdsm_03934 (fadJ_3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RIdsm_03934 (fadJ_3)
   00930 Caprolactam degradation
    RIdsm_03934 (fadJ_3)
Enzymes [BR:rid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RIdsm_03934 (fadJ_3)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RIdsm_03934 (fadJ_3)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RIdsm_03934 (fadJ_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C MotA_ExbB F420_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QEW28109
Position
4026058..4028259
Genome map
AA seq 733 aa AA seqDB search
MTDFTMEKGADGVAVITWDTEGKSMNVMTMEAWPVLDGLIDDALADDAVKGIVITSGKDG
TFAGGMDLNVISKMKDMAGDEPAKGLFEGLMNMHGILRKIERAGMDDKNKGGKPIAAALP
GTALGIGLEIPLACHRIFAADNPKAKIGLPEIMVGIFPGAGGTTRLVRKLGAMAASPLLL
QGKLNDPKKAKSAGVVDEVVAPEELLDKAKEWVLSEPQIVKPWDEKGYKMPGGAPYHPAG
FMTFVGASAMVNKETQGAFPAAKALLSAVYEGALVPFDTALKIEARWFTNVLMNPSSSAM
IRSLFVNKEALEKGANRPDVPDQKVKKVGVLGAGMMGAGITLVSAMAGMQVVLIDQKQEA
ADKGKSYTADYMDKGIKRGKATEEKKTAALDLITATTDYAALDGCDLIIEAVFEDPKVKA
EVTKQALANVGEDCIFATNTSTLPITELAKASDTPDQFIGIHFFSPVEKMMLVEIIKGKE
TGPRAVAKALDYVRQIRKTPIAVNDARFFYCNRCIIPYINEGIRMVAEGVAPALIDNAAR
QLGFPVGPLQLVDETSIDLGAKIARATKAAMGDDYPDEAVDEVIFWMEGEGRLGRKSKAG
FYDYDEKGKRQGYWPGLAEKYPRAAEQPDLIEVQHRLMFAQVLEAVRALEEGVLEDIREG
DVGAILAWGFAPWSGGPFSWLDIIGAPYAAERCDQLTEKFGPRFTTPDLLRELAEKNQTF
YARFGTASEDEAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttcacgatggaaaaaggcgccgatggcgtcgccgtcatcacctgggacacc
gaaggcaagtccatgaacgtgatgaccatggaagcctggcccgtgctcgacgggctgatc
gacgacgcgctggccgatgacgcggtcaagggcatcgtcatcacctcgggcaaggacggc
acctttgccggcggcatggacctcaacgtcatctcgaaaatgaaggacatggcgggcgac
gagccggccaagggcctcttcgaggggctgatgaacatgcacgggatcctgcgcaagatc
gagcgcgcggggatggacgacaagaacaagggcggcaagcccatcgccgccgccctcccc
ggcacggcgctcggtatcggcctcgaaatcccgcttgcctgccaccgcatcttcgccgcc
gacaacccaaaggccaagatcggcctgccggagatcatggtcggcatcttccccggtgcg
ggcggcaccacgcggctggtgcggaagctgggcgcgatggcggcgagcccgctgttgttg
cagggcaagctgaacgaccccaagaaagccaaatccgccggcgtcgtcgacgaggtcgtg
gccccggaggaactgctcgacaaggccaaggaatgggtcctctccgagccgcagatcgtc
aagccgtgggacgagaagggctacaaaatgcccggcggcgccccctaccacccggcgggc
ttcatgaccttcgtcggcgcctcggccatggtgaacaaggaaacgcaaggcgccttcccc
gccgccaaggccctcctctccgccgtctatgaaggcgcgctcgtgcccttcgacaccgct
ctgaagatcgaggcgcgctggttcaccaatgtcctgatgaacccgtcctcctcggccatg
atccgctcgctcttcgtcaacaaggaagcgctggaaaaaggcgccaaccgccccgacgtg
ccggatcagaaggtcaagaaggtcggcgtgctcggcgccggcatgatgggcgcgggcatc
accctcgtctcggccatggccggcatgcaggtcgtgctgatcgaccagaaacaggaagcg
gccgacaagggcaaatcctacaccgccgactacatggacaagggcatcaagcgcggcaag
gcgaccgaagagaagaagaccgccgccctcgacctcatcaccgccaccaccgattacgcg
gcgctcgacggctgcgacctgatcatcgaggcggtgttcgaagatccgaaggtgaaggcc
gaggtcaccaagcaggcgctggccaacgtgggcgaggattgcatcttcgccactaacacc
tcgaccctgccgatcaccgagctggccaaggcgtcggacacccccgaccagttcatcggc
atccacttcttctcgcccgtcgaaaagatgatgctggtcgagatcatcaaggggaaagag
accggcccccgtgccgtggccaaggcgctcgactatgtccgccagatccgcaagaccccg
atcgcggtgaacgatgcgcgcttcttctactgcaaccgctgcatcatcccctacatcaac
gagggcatccgcatggtggccgagggcgtcgcccccgcgctcatcgacaacgcggcgcgc
cagctgggcttccccgtggggccgctgcaactcgtcgatgaaacctccatcgacctcggc
gccaagatcgcccgcgccaccaaggcggcgatgggcgacgactaccccgacgaggccgtc
gacgaggtcatcttctggatggaaggcgaagggcgcctgggccgcaaatccaaggcgggc
ttctacgactacgacgagaagggcaaacgccagggctactggcccggtctggccgagaaa
tacccccgcgccgccgaacagcccgacctcatcgaggtgcagcatcgcctgatgttcgcc
caggtgctcgaagcggtccgcgcgctggaggaaggcgtgctggaagacatccgcgaaggc
gatgtcggcgccatcctcgcctggggcttcgccccctggtcgggcggcccgttctcgtgg
ctcgacatcatcggggcgccttacgccgccgagcgttgcgaccagctgaccgagaaattc
ggcccccgcttcaccacccccgacctgctgcgcgagctggccgagaagaaccagaccttc
tacgcccgcttcggcaccgcgtcggaagacgaagccgcctga

DBGET integrated database retrieval system