KEGG   Candidatus Riesia sp. GBBU: AOQ88_00810Help
Entry
AOQ88_00810       CDS       T04782                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rig  Candidatus Riesia sp. GBBU
Pathway
rig00564  Glycerophospholipid metabolism
rig01100  Metabolic pathways
rig01110  Biosynthesis of secondary metabolites
Module
rig_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rig00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOQ88_00810
Enzymes [BR:rig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AOQ88_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ARC54792
UniProt: A0A1V0HPP7
Position
complement(175482..176312)
Genome map
AA seq 276 aa AA seqDB search
MRFIITKIFGWFANKKIVLFTSIIIRIFARVYKIDIKESKKNKFSYYKTFNQFFTRSLKK
DLRPIIAKFHQISSPVDGKIVKFGKIKKFSQFKVKRNFLNLDSLFGKDKTLVNMFRNGKF
ITIYLAPFNCHRVYMPFDGFLKKIIYIPGKFFSVKINNLRKYPNILCENERLICIFDTRI
GKIAQILVGSIIVGKIETIWHKKISKRYFNKVNKWEYSKTENKKYFFLKKGKEMGRFSLG
STVINIFEPNRIKFISSIKDDLSVKIGEPLANTKFL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagatttattataacgaaaatatttggatggtttgctaataagaaaatagtattattt
acatctataattattagaatcttcgcaagagtttacaaaattgatataaaagaatctaaa
aaaaataaattctcttactataaaacttttaaccagttctttacaagatctttaaagaaa
gatttacgtccaataattgcgaaatttcatcaaatatcttctccggtagatggaaaaata
gtaaaatttggaaaaattaaaaaatttagtcagtttaaggtaaaaagaaattttttaaat
ttagattctttatttgggaaagataaaacattggtaaatatgtttagaaatggaaaattt
attactatttacttggctccatttaattgtcatagagtatatatgccatttgatggattt
ttaaaaaaaataatatatattcctggaaaatttttctctgtaaaaataaataatttaaga
aaatatcctaatattttatgtgagaatgaaagattaatttgtattttcgatacaagaata
ggaaaaattgcacaaattttagtaggatcgattatagttgggaaaatagaaacaatttgg
cataaaaaaataagtaaaagatatttcaataaagtaaataaatgggaatattcaaaaaca
gaaaataaaaaatatttttttttaaaaaaagggaaagaaatgggaagatttagtttaggt
tctactgtaataaatatttttgagccaaatagaattaaattcatttcatctattaaagat
gatttatcagtaaaaattggtgaaccactagcaaacacaaaatttctataa

DBGET integrated database retrieval system