KEGG   Roseburia intestinalis M50/1: ROI_30650Help
Entry
ROI_30650         CDS       T02598                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rim  Roseburia intestinalis M50/1
Pathway
rim00071  Fatty acid degradation
rim00280  Valine, leucine and isoleucine degradation
rim00310  Lysine degradation
rim00362  Benzoate degradation
rim00620  Pyruvate metabolism
rim00630  Glyoxylate and dicarboxylate metabolism
rim00640  Propanoate metabolism
rim00650  Butanoate metabolism
rim00900  Terpenoid backbone biosynthesis
rim01100  Metabolic pathways
rim01110  Biosynthesis of secondary metabolites
rim01120  Microbial metabolism in diverse environments
rim01130  Biosynthesis of antibiotics
rim01200  Carbon metabolism
rim01212  Fatty acid metabolism
rim02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROI_30650
   00630 Glyoxylate and dicarboxylate metabolism
    ROI_30650
   00640 Propanoate metabolism
    ROI_30650
   00650 Butanoate metabolism
    ROI_30650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ROI_30650
   00072 Synthesis and degradation of ketone bodies
    ROI_30650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROI_30650
   00310 Lysine degradation
    ROI_30650
   00380 Tryptophan metabolism
    ROI_30650
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROI_30650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROI_30650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROI_30650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rim04147]
    ROI_30650
Enzymes [BR:rim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ROI_30650
Exosome [BR:rim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROI_30650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF1153
Motif
Other DBs
NCBI-ProteinID: CBL09944
UniProt: D4KSU2
Position
3078525..3079706
Genome map
AA seq 393 aa AA seqDB search
MAKKVVLAGACRTAIGKMGGALSNTPAADLGAIVIKEALRRANVKPEMVDEVKMGCVIQA
AQGQNVARQAAIKAGLPIEVPAITINVVCGSGLKCVNDAATMIMAGEADIVVAGGMENMS
MAPYAMTKARFGYRMNNATIIDTMVNDALTDAFNHYHMMITAENVCDKYGITREELDEFS
ANSQQKCEKAIAEGKFDDEIVPVPVKVKKEIVDFVKDEGPRAGTTAESLAKLKCCSGKEG
GLVTAGNASGINDGAAAIVVMSEEKAKELGVTPMATWVAGALGGVEPEIMGVGPVASTRK
VLAKTGLSIDDMDLIEANEAFAAQSIAVARDLKFDMSKVNVNGGAIALGHPVGASGCRIL
VTLLHEMQKRDAKRGLATLCIGGGMGCSTIVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagtagttttagcaggtgcctgccgtaccgcaatcggtaaaatgggtgga
gcattaagcaatactccagcagcagacttaggtgcaatcgttatcaaagaggctttaaga
agagcaaacgttaaaccggagatggttgacgaggtaaaaatgggttgtgtaatccaggca
gctcagggacagaacgttgcacgtcaggcagcaatcaaagcaggactgccaatcgaagtt
ccggcaatcacaatcaacgttgtttgtggttctggtttaaaatgtgtcaatgatgcagct
accatgatcatggcaggtgaagctgatatcgttgttgcaggtggtatggaaaacatgtct
atggcaccatatgctatgacaaaagctcgttttggatatcgtatgaacaatgcaacgatc
atcgatacaatggtaaatgatgcattaacagatgcattcaaccactatcatatgatgatc
actgcagagaacgtatgtgataaatatggcattacaagagaagaacttgacgagttctca
gcaaacagccagcagaaatgtgaaaaagcaatcgctgaaggcaaatttgatgatgagatc
gttccagttcctgttaaagtgaaaaaagagatcgttgatttcgtgaaagatgagggacca
cgtgccggtacaactgctgagtctttagcaaaattaaaatgctgctccggtaaagagggc
ggacttgttacagcaggtaacgcttccggtatcaacgatggtgcagcagcaatcgttgtt
atgagtgaagaaaaagcaaaagagcttggtgttacaccaatggctacatgggtagcaggt
gctcttggcggagttgagccagagatcatgggtgttggtcctgttgcttctacaagaaaa
gtattagctaaaacaggtttatccattgatgatatggacttaatcgaagcaaacgaagca
ttcgcagctcagtctattgcagtagcaagagatctgaaattcgatatgtcaaaagtaaac
gtaaacggtggtgcaatcgcattaggacacccggtaggtgcttccggatgccgtatcctt
gttacattactgcatgagatgcagaagagagacgctaagagaggtcttgctacactttgc
atcggcggtggtatgggatgctctacaatcgttgagagataa

DBGET integrated database retrieval system