KEGG   Roseburia intestinalis M50/1: ROI_33260Help
Entry
ROI_33260         CDS       T02598                                 

Definition
(GenBank) Glycosidases
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
rim  Roseburia intestinalis M50/1
Pathway
rim00500  Starch and sucrose metabolism
rim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROI_33260
Enzymes [BR:rim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     ROI_33260
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     ROI_33260
    3.2.1.135  neopullulanase
     ROI_33260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N Secretogranin_V Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CBL10168
UniProt: D4KTG6
Position
3322162..3323880
Genome map
AA seq 572 aa AA seqDB search
MEYSAIYHDMDKRFCYAINKDLFVIRVQVKKDDMKEIILHCEDKYIPMECKDTRKTILMK
KIATSQFHDYYEAQLQMHLICLRYYFEFTDTQGEKIYYGNYEFSKECITNRDRMFDCPQN
LREEEMFEVPDWAANKVVYQIFPARFAASQQVDKEQWYKAPISSMDDLHGDLRGIIEHLD
HVQNLGIDVLYMTPVFKSNSSHKYDTIDYYQIDPSFGTTEDLRELVQEAHKRGMKIVMDA
VFNHTGREFFAFEDIMEKGEKSKYLDWYYIEKFPLKSERGEIPNYKCFGYYGGMPKLNLK
NPEVEKFITDVACYWIKECNIDGWRMDVGDEISHYFWKNFRRAVKAVKKDMLIIGEIWHY
AGDFLEGDEWDTVMNYPFYLNLIDLLADEKIQVSQFVQNLGYLKGRLNKKCYPLMWNLID
SHDTARFLHLCNENKKKQHLAAAFQLLLPGMPMIYYGDEFAMPGANDPDCRRGMYWDEEY
QDKEMYEWYKQLLWIRKKHACISEGELIGAITKDEEETIVLIRKNVEETIALIFNCSSNA
KNFSEYEGKYNLLRDEPFNGKVEGLDAAVIVL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggaatattcagcaatttatcatgatatggacaaaagattctgttacgcaattaataag
gatctgtttgtgatacgtgtgcaggttaaaaaagatgatatgaaggagatcatccttcac
tgtgaagataagtatataccaatggagtgcaaggatacgcgtaagactattctgatgaag
aagattgccacttcacagtttcatgattattatgaagcacagcttcagatgcatctgata
tgtctcagatattattttgaatttacggacacgcagggtgaaaaaatatattatggcaat
tatgagttttctaaggaatgcatcacaaacagggacagaatgtttgattgtccgcagaat
cttcgggaagaagaaatgtttgaggtgccggactgggcagcaaataaggtcgtgtatcag
atttttccggcccgttttgcagcatcgcagcaggtagataaggaacaatggtataaagca
ccaatttcgtctatggatgatctgcatggtgatctcagaggaataattgaacatctggat
cacgttcagaatctgggaatcgatgttttgtatatgacacctgtctttaaatcaaattca
agtcataagtacgataccattgattattatcagatcgatccatcatttggaacgacagaa
gatctcagggaactggtacaggaagctcataagcgtggaatgaaaatcgtcatggatgca
gtgttcaaccatacaggaagagaattttttgcatttgaagatatcatggaaaaaggagaa
aaatcgaagtatctggactggtattatattgagaaatttccacttaaaagtgaaagagga
gagattccaaactataaatgcttcggatactatggcggaatgcctaagctaaatctgaaa
aatcctgaagttgagaaattcattacagatgttgcgtgctattggattaaggaatgtaat
attgacggatggcgaatggatgtaggagacgagatcagtcattatttctggaagaatttt
agaagagcggtcaaggctgtaaaaaaggatatgctgatcattggagaaatctggcattat
gcaggagattttcttgagggagacgaatgggatacggtcatgaactatccgttttatctg
aatctgatcgatctgctggcagatgaaaagatacaggtcagtcagtttgtacagaattta
ggatatttgaagggacgtttaaataaaaaatgttatcctcttatgtggaatctgattgac
agccatgacacagcaagatttttacatctgtgtaatgaaaataagaaaaaacagcatttg
gcagcggcttttcagctgttattgccgggaatgccaatgatttattatggggatgagttt
gcgatgccgggagcaaacgatccggattgcaggcgcggtatgtactgggatgaagaatac
caggacaaagagatgtatgaatggtataaacagctgctttggatccgaaaaaaacatgcg
tgtatttcagaaggcgaactgatcggggcaattacaaaggatgaggaagaaacaatagtc
ctgattcgaaaaaatgtcgaagagacaattgccttgatttttaattgcagcagtaatgca
aagaactttagcgagtatgagggaaaatataatttgcttagagatgaaccgtttaatgga
aaagttgaggggcttgatgctgcggtaatcgtgctttaa

DBGET integrated database retrieval system