KEGG   Roseburia intestinalis M50/1: ROI_35390Help
Entry
ROI_35390         CDS       T02598                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
rim  Roseburia intestinalis M50/1
Pathway
rim00670  One carbon pool by folate
rim00790  Folate biosynthesis
rim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ROI_35390
   00670 One carbon pool by folate
    ROI_35390
Enzymes [BR:rim01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ROI_35390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 RibD_C
Motif
Other DBs
NCBI-ProteinID: CBL10347
UniProt: D4KTZ5
Position
3543676..3544170
Genome map
AA seq 164 aa AA seqDB search
MNLIVAADENWAIGNKNELLVRIPADQKFFRETTMGKVVVMGRKTLETFPNGLPLMGRTN
IVLTHDKKFRVPGALIVHDMEELHEELKKYDSEDIYVIGGESVYRQLIDECDVAHVTKID
FAYDADAHFPDLDADPAWEITADSEEQTYFDLEYYFYRYERVRK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattgtagcggcagatgaaaactgggcgatcggtaataaaaatgaattgtta
gtccggattccggcagatcagaaatttttccgtgaaacaacgatgggaaaagtagttgtg
atggggcggaaaacgttagaaacatttccgaatggacttccactgatggggcggacgaat
attgtgctgacacatgataaaaagttccgggttccgggagctttgatcgtacatgatatg
gaagaacttcatgaagaactgaaaaagtacgatagtgaagatatttatgtgatcggcggc
gaatccgtatataggcagctcatcgatgaatgtgatgtggcgcatgtcacaaaaatcgat
tttgcatacgatgcggatgcacatttcccggatctggatgcagatccggcatgggagata
acggcagacagtgaggaacagacgtattttgatcttgagtattatttttaccggtatgag
agagtcagaaaataa

DBGET integrated database retrieval system