KEGG   Ralstonia insidiosa: ACS15_0195Help
Entry
ACS15_0195        CDS       T04471                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rin  Ralstonia insidiosa
Pathway
rin00071  Fatty acid degradation
rin00072  Synthesis and degradation of ketone bodies
rin00280  Valine, leucine and isoleucine degradation
rin00310  Lysine degradation
rin00362  Benzoate degradation
rin00380  Tryptophan metabolism
rin00620  Pyruvate metabolism
rin00630  Glyoxylate and dicarboxylate metabolism
rin00640  Propanoate metabolism
rin00650  Butanoate metabolism
rin00900  Terpenoid backbone biosynthesis
rin01100  Metabolic pathways
rin01110  Biosynthesis of secondary metabolites
rin01120  Microbial metabolism in diverse environments
rin01130  Biosynthesis of antibiotics
rin01200  Carbon metabolism
rin01212  Fatty acid metabolism
rin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACS15_0195
   00630 Glyoxylate and dicarboxylate metabolism
    ACS15_0195
   00640 Propanoate metabolism
    ACS15_0195
   00650 Butanoate metabolism
    ACS15_0195
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACS15_0195
   00072 Synthesis and degradation of ketone bodies
    ACS15_0195
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACS15_0195
   00310 Lysine degradation
    ACS15_0195
   00380 Tryptophan metabolism
    ACS15_0195
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACS15_0195
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACS15_0195
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACS15_0195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rin04147]
    ACS15_0195
Enzymes [BR:rin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACS15_0195
Exosome [BR:rin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACS15_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANH73311
Position
1:complement(199969..201150)
Genome map
AA seq 393 aa AA seqDB search
MSDRIVIVSAARTPMGAFQGELASLTAPQLGAAAIRAAVERAGLKPEQIEEVIMGCVLPA
GQGQAPARQAALGAGLPLSVGCTTVNKMCGSGMRAAMNAYDALLAGSLDVVVAGGMESMT
NAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFGEDCAEKYGFTREAQDHF
AMTSVRRAQEATESGAFRWEITPVTVSSKTGDTIIDTDEGPRRIKVDKIPSLKPAFKKDG
TVTAASSSSINDGAAALVMMRESTAKQLGITPLAVMLGHTTHAQAPGWFTTAPVAAIDKL
FKKLDWNSNNVDLFEINEAFAVVPMAAMHDLHIPHEKVNVNGGACALGHPIGASGARVMA
TLLGALQHRGGKRGVASLCIGGGEATAVGIELY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccgcatcgtcatcgtctcagcagcccgcaccccgatgggcgccttccagggc
gaactcgccagcctcactgccccgcaactcggcgccgccgccatccgcgcggcagtcgaa
cgcgccggcctgaagcccgagcagatcgaagaagtcatcatgggctgcgtcctgcccgca
ggccaaggtcaagcaccggcccgccaggcagcactcggcgcaggcctgccgctgtcggtc
ggctgcaccacagtcaacaagatgtgcggctcgggcatgcgcgctgcgatgaacgcctac
gacgcactgctggcaggctcgctggatgtggtggtcgcgggcggcatggaaagcatgacg
aatgcgccctacctgatcccgaagggccgcggcggctaccgcatcggccacggcatgatc
tacgaccacatgatgctggacggcctggaagacgcgtatgacaaaggccgcgccatgggc
accttcggcgaggactgcgccgagaagtacggcttcacgcgcgaggcacaagaccacttc
gcgatgacctccgtgcgccgcgcgcaggaagccaccgaatccggcgcgttccgctgggag
atcacccctgtcaccgtgtcgagcaagaccggcgacaccatcatcgataccgatgaaggc
ccgcgccgcatcaaggtcgacaagatcccctcgctcaagcccgccttcaagaaggacggc
acggtgacggccgcttcgtcttcatcgatcaacgatggcgctgcggcgctggtgatgatg
cgcgaatccactgccaagcaactcggcatcacgccgctggcggtcatgctcggccacacc
acccatgcgcaggcgccgggctggttcaccaccgcgccggtcgcagccatcgacaagctg
ttcaagaagctcgactggaacagcaacaatgtcgacctgttcgagatcaacgaggcgttt
gccgtggtgccgatggcggccatgcacgacctgcacatcccgcacgagaaggtgaacgtg
aacggcggcgcgtgtgcgctgggccatccgatcggcgcatcgggtgcccgcgtgatggcc
acgctgctgggtgcgttgcaacaccgtgggggcaagcgtggcgtagcgagcctgtgcatc
ggcggcggtgaagccaccgccgtgggcatcgaactctactga

DBGET integrated database retrieval system