KEGG   Ralstonia insidiosa: ACS15_2518Help
Entry
ACS15_2518        CDS       T04471                                 

Definition
(GenBank) glycosyltransferase Family 4 family protein
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
rin  Ralstonia insidiosa
Pathway
rin00500  Starch and sucrose metabolism
rin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACS15_2518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rin01003]
    ACS15_2518
Enzymes [BR:rin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ACS15_2518
Glycosyltransferases [BR:rin01003]
 Polysaccharide
  Storage polysaccharide
   ACS15_2518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_tranf_2_3 Glyco_trans_1_2 Glycos_transf_2 Glyco_trans_2_3 Glyco_tranf_2_2 Glyco_transf_5 Glyco_transf_21 Glyco_trans_4_2 Glyco_transf_7C
Motif
Other DBs
NCBI-ProteinID: ANH73565
Position
1:2532482..2534605
Genome map
AA seq 707 aa AA seqDB search
MKAYAGQVKIGNCPEANLSKSRNVGIALSTGDIVCFIDDDAVPEPDWLDKLETGYSDPNV
AAVGGYIRNHTGVEFQCKVTVCDRFGDGHGFESIEAANPDAGPNSKRYLALTGTNSSFRR
HALLEIGGFDEEYAYFLDETDVIVRLIDRGYKVEYVPDAEIHHKYAASHLRTTSKLPKTI
YLPVRSKAYFCVQNALPGTPYTEIVSFLQRYASGLKKDKKWYLDNGMIDAPHYHRLISEI
DKGIYDGVADAHSHPNRRVMTQKYWTDRAQEFHAFKPLLSAEKRLKICLLSQDYPPAQCG
GIGVWTHELATGLARMGHEVSVVTRGHDHPTVDFEDGVWVHRIVPVWWPDRATPALPDIP
PVIRDYAYTAFDEVQRIHARRGLDVVSSPIWDLEGIACIADGSIPTILSLHTTFKLALPF
KPEWTSNQEYKTHHVDKIIRGEEWVLNHAKHILANSHAVIQDIEREYGMKISRSHTSIVP
HGIEDYSEKESLPSKNNGEQKLLFVGRFERRKGIDLLLEVIPTLLRKYKNLKVDLVGENN
LPAADQATYKDLFVAAHKGQADILDRVNFVGTVSKAELLNAYQNCDIFAAPSRYESFGLI
LIEAMRFGKAVVGARIGGMQEVVSDGVDGLLFKSEDAADLRQKLDQILGDPDLRNRLGRA
ARESFETKFSTEVMCDAVAKVYAQLHPTESAEDVLGKTPVEVKRKAA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcttatgcgggccaagtgaaaatcgggaattgccccgaggccaatctctcaaag
tcccgcaatgtcgggattgccctctccacaggggatatcgtttgctttattgacgacgat
gccgtccccgagcccgattggctcgataaactcgagacagggtattccgacccgaatgtc
gctgccgttggtggatacattcgaaatcataccggcgtcgaattccaatgcaaggtcacc
gtttgcgatcgttttggcgatggccatggcttcgaaagcatcgaagcagccaatccagac
gcgggaccgaactcgaagcgctatctggccctgaccggaacaaattcgtccttccgtcga
cacgccctgcttgagatcggaggctttgatgaggaatacgcctatttccttgacgaaacg
gacgtgattgttcggctgattgaccggggctacaaggttgaatacgtccctgatgcggag
attcatcataagtatgcggctagccatctccgtaccacatcaaagctacctaaaacgatc
tatctcccggtacgcagcaaagcgtatttctgcgtccagaatgcgctgccaggcacaccc
tatactgagattgtgtccttccttcaacgctatgcgtccggcctgaagaaggacaagaag
tggtatctcgacaatgggatgattgatgctccgcactatcaccgcctaattagcgagatt
gacaaaggaatctatgatggcgtggcggatgcgcacagccaccccaatcgccgcgtcatg
acgcagaaatactggacagatcgggcgcaggaattccacgccttcaaaccacttctttct
gccgaaaaacgcctgaagatctgcttgctcagccaagactatccgcccgcccaatgcggt
ggtatcggcgtatggacgcatgaactcgcgaccggcctcgcgagaatgggacatgaagtg
agcgtcgtaactcgggggcacgatcatccgaccgtcgatttcgaggatggcgtctgggtg
catcggatcgtgcctgtatggtggccagaccgcgctacgccggcactccccgatattccg
cccgtcattcgcgactacgcctataccgcgttcgatgaagtccagcgaattcatgctcgg
cgtggcttggatgttgtgtcctctccaatctgggatctagagggtatcgcctgcatcgct
gacggcagcattcccaccatcctcagtctgcacacgacattcaagctggctcttccattc
aagccggaatggacgtccaaccaagaatacaagacacatcacgtagacaagatcattcga
ggggaagaatgggttttgaatcatgcgaaacatattctcgcgaattcccatgccgttatc
caggacatcgagcgcgaatatggcatgaaaatctcgcgcagccatacatccatcgttcct
cacggaattgaggattactctgaaaaagaatccttgccatcgaagaataacggcgaacaa
aaactgctattcgttggtcggttcgagcgacgcaagggcattgacctgctgcttgaagtc
attcctacgctgctgcgcaaatacaagaaccttaaagttgacttggttggtgaaaacaat
ctccctgctgcggatcaagccacatacaaggatctctttgttgccgctcacaagggccaa
gcggacattctggatcgcgtgaattttgtaggcacggtatccaaggcagagttgctgaac
gcataccagaactgcgatatcttcgcagcgccaagccgatatgaatcctttggcctgatc
ctgatcgaggcaatgcgatttggcaaagctgttgtgggtgcgcgcatcggtgggatgcag
gaagttgtctcggacggtgtcgacgggcttctgttcaagtccgaagatgcggcagatcta
cggcaaaagctcgatcagattctcggcgatccagacctgcgcaaccgactgggtcgtgcc
gcacgcgaatccttcgaaactaagttctccactgaggtcatgtgtgatgcggttgctaaa
gtctacgcacagctgcaccccactgaatccgccgaagatgtactaggtaaaactccagta
gaagtcaagcgcaaagcggcttaa

DBGET integrated database retrieval system