KEGG   Ralstonia insidiosa: ACS15_3378Help
Entry
ACS15_3378        CDS       T04471                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rin  Ralstonia insidiosa
Pathway
rin03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rin00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ACS15_3378 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rin03011]
    ACS15_3378 (rplV)
Ribosome [BR:rin03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ACS15_3378 (rplV)
  Bacteria
    ACS15_3378 (rplV)
  Archaea
    ACS15_3378 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF5610
Motif
Other DBs
NCBI-ProteinID: ANH73563
UniProt: A0A192A0Q9
Position
1:complement(3420834..3421163)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLSIERALNVLTFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaaagcgattcatcgcggcgcccgtatctccgcacagaagacgcgcctggtt
gctgaccagatccgcggcctgtcgatcgagcgcgcgctcaacgtgctgacgttcagcccg
aagaaggcggctggcatcgtgaagaaggtggttgagtccgccatcgcgaacgccgagcac
aacgaaggcgccgatatcgatgagctgaaggtcaagtcgatctacatcgacaaggcaacg
tcgctcaagcgcttcaccgcgcgcgcgaagggccgtggcaaccgcatcgagaaacaaacc
tgtcacatcactgtgacattgggcaactaa

DBGET integrated database retrieval system