KEGG   Ralstonia insidiosa: ACS15_3979Help
Entry
ACS15_3979        CDS       T04471                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
rin  Ralstonia insidiosa
Pathway
rin00620  Pyruvate metabolism
rin00630  Glyoxylate and dicarboxylate metabolism
rin01100  Metabolic pathways
rin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACS15_3979
   00630 Glyoxylate and dicarboxylate metabolism
    ACS15_3979
Enzymes [BR:rin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     ACS15_3979
    1.2.1.22  lactaldehyde dehydrogenase
     ACS15_3979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANH76650
Position
2:67228..68652
Genome map
AA seq 474 aa AA seqDB search
MRTERNYVNGRFADAQCDAVIVVHNPATEAPFARVSAATADEAVAAVEAAAAAQKAWRKL
PSTERAAYLHKLADALTARAPEISAALARESGKSLEDASNEAIYAGQITRYHAEWARRIE
GEVIPSDAPDESLFLQREPIGVVACLIPFNYPVYTLLRKIAPALITGNTVVVRPSNNTPV
SAFEIAKAVEDAGFPPGVVNILAMDHATAEVLCTHAAVGMITLTGSVNAGRKVLDYCKVN
IAKPSLELGGKTPAIVEPDTDLEAVAAALVAAKVAHCGQRCTAIERVYVHESVHDRFVAL
LKGQMAAVRIGDRAVDPSCMGPQVSALARAGIHAMVEGAIADGATLETGGKLPDGPGFFY
PATLLTNCRQDMEIVQEETFGPILAVLRYSTIDEAIALANDHQFGLASVLYTENYRTAMK
VANAIESGELYVNRTPADPYQGYHAGWKRSGLGGDDGKHGMLEFTQTRLVVMKY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccgagcgcaactatgtgaacggccggtttgccgatgcgcaatgcgatgcagtc
atcgttgttcataaccccgccaccgaagcaccgtttgcacgcgtgtcggcggcgacagcc
gatgaggcagtcgccgctgtcgaggcagcggccgccgcgcagaaggcctggcgcaagctg
ccgagcaccgagcgcgcagcttacctgcacaagctcgccgacgcgctgacggcgcgtgcc
cccgagattagcgcagcgctcgcgcgggagtcgggcaagagcctggaagacgcttcaaac
gaagccatctacgccggtcagatcacgcgctatcacgccgagtgggcacgccggatcgag
ggggaggtgatccccagcgatgcgccggacgagagcctcttcctgcaacgcgagccgatc
ggcgttgtggcgtgcctgattccgttcaactaccccgtctatacgctgctgcgaaagatc
gccccggcgctgattacgggcaacaccgtggtggttcggcccagcaacaacacgcccgtt
tcggctttcgaaattgcaaaggcggttgaggatgccggctttccgccgggtgtcgtcaac
attctggcgatggatcacgccacggccgaggtgctatgcacccacgcggcggtcggcatg
atcacgctcacgggcagcgtgaatgccggccgcaaggtactcgactactgcaaggtgaac
attgccaagccgtcgctggagcttggcggcaagacgcctgccatcgttgagccggataca
gacctggaagcggtggccgctgcgcttgtcgcggccaaggtcgcacattgcggtcaacgt
tgcacggccatcgagcgcgtgtacgtgcatgagagcgtgcacgaccgctttgtcgccctg
ctcaaggggcagatggccgccgtgcgcatcggtgaccgtgcggttgatccgtcgtgcatg
gggccccaggtgagcgcattggcgcgcgccggcattcacgcgatggtcgagggtgccatt
gccgacggtgcaacgctggagaccggcggaaagctgcccgatggtcccggcttcttttac
ccggccacgctgctgaccaactgccgtcaggacatggagatcgttcaggaagagaccttc
ggtccgattctggccgtgctgcgctactccacgatcgacgaagccattgccttggccaac
gaccatcagttcggcctggcatcggtgctctacaccgagaactaccgcaccgccatgaag
gtggccaatgccatcgaatctggcgagctgtacgtcaaccgcacaccggctgatccatac
cagggctaccacgccggctggaagcgatccggccttggcggcgacgacggcaagcacggg
atgctcgagttcacgcaaacacgtctggtggtcatgaagtactga

DBGET integrated database retrieval system