KEGG   Ralstonia insidiosa: ACS15_5298Help
Entry
ACS15_5298        CDS       T04471                                 

Definition
(GenBank) bifunctional NMN adenylyltransferase/Nudix hydrolase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
rin  Ralstonia insidiosa
Pathway
rin00760  Nicotinate and nicotinamide metabolism
rin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACS15_5298
Enzymes [BR:rin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     ACS15_5298
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     ACS15_5298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like NUDIX_4 FAD_syn
Motif
Other DBs
NCBI-ProteinID: ANH76371
Position
2:1438105..1439142
Genome map
AA seq 345 aa AA seqDB search
MSTNAKRFDALVFIGRFQPMHRGHLDVLRRALSLADTVCVLIGSTDKPRTIKDPFSFDER
RQMIASALDAASRTRVRFAPVQDSTYNDGDWVRWVQDAVAAELGDTAGRKIGIIGHEKDG
TSYYLRMFPQWELVEVDSTEDISATEIREQFLAERSNSFVSWAVPAPVFEWMESFRNQPA
FAQLKAEAEFIAGYKKAWSAAPYPVTFVTVDAVVVHSGHLLLVRRRSEPGRGLWALPGGF
VNQEERLEAACLRELREETGLKLPEPVLRGSLKDRQVFDHPQRSLRGRTITHAFLFSFPV
GELPRVKGGDDADKARWVPLNDFARMRSVMFEDHFDIAYHFLGKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaatgcaaagcgcttcgatgcgcttgtcttcatcggccgtttccagccgatg
caccgtggacaccttgacgtactgcgccgggcattgagccttgccgatacggtttgcgtc
ctgatcggctcgaccgacaaaccccgcaccatcaaagacccgttctcgttcgacgagcgc
cggcagatgattgcctctgcgctggacgcggcgtcccgcacccgcgtgcgctttgcgccg
gtgcaagactccacctacaacgacggcgactgggtccgctgggtacaagacgcggtggcc
gccgaactgggcgacaccgctggccgcaagatcggcatcatcggccacgagaaggacggc
acctcgtactacctccgcatgtttccgcagtgggagctggtggaagtcgacagcaccgaa
gacatttccgccaccgagatccgcgagcagttcctggccgagcgcagcaacagcttcgtg
tcgtgggctgtgcccgcgccggtgttcgagtggatggagagcttccgcaaccagccggcg
ttcgcgcaactgaaggcggaagcggagttcattgccggctacaagaaagcctggtcggcg
gcgccgtatccagtcaccttcgtcaccgtcgatgcggtggtcgtgcattccggccacctg
ctgctggtgcgccggcgcagcgagcccgggcgtggcctgtgggcgctgccgggcggcttc
gtgaaccaggaggaacggctggaggccgcatgcctgcgcgagttgcgcgaagagaccggg
ctcaagctgccggagcccgtgctgcgcggctcgttgaaagaccggcaggtgtttgatcac
ccgcaacgctcgctgcgcgggcggacgatcacgcacgcgttcctgttcagctttcccgtg
ggtgagctgccgcgcgtcaagggcggcgacgatgccgacaaggcgcgctgggtcccgctg
aacgacttcgcgcgcatgcgcagcgtcatgtttgaggaccacttcgacatcgcctaccac
ttcctcggcaagctctaa

DBGET integrated database retrieval system