KEGG   Candidatus Riesia pediculicola: RIEPE_0034Help
Entry
RIEPE_0034        CDS       T01218                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00010  Glycolysis / Gluconeogenesis
rip00030  Pentose phosphate pathway
rip00051  Fructose and mannose metabolism
rip00680  Methane metabolism
rip01100  Metabolic pathways
rip01110  Biosynthesis of secondary metabolites
rip01120  Microbial metabolism in diverse environments
rip01130  Biosynthesis of antibiotics
rip01200  Carbon metabolism
rip01230  Biosynthesis of amino acids
rip03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIEPE_0034 (pfkA)
   00030 Pentose phosphate pathway
    RIEPE_0034 (pfkA)
   00051 Fructose and mannose metabolism
    RIEPE_0034 (pfkA)
   00052 Galactose metabolism
    RIEPE_0034 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    RIEPE_0034 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RIEPE_0034 (pfkA)
Enzymes [BR:rip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RIEPE_0034 (pfkA)
Protein phosphatases and associated proteins [BR:rip01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RIEPE_0034 (pfkA)
Messenger RNA biogenesis [BR:rip03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RIEPE_0034 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADD79411
UniProt: D4G7K7
Position
28645..29649
Genome map
AA seq 334 aa AA seqDB search
MMNRGKIKRIGILTSGGDAPGMNAAIRSVVKMSISQGLEIYGIHDGYMGLYENRIEKLNN
GLVSDIISKGGTFLGSARFPEFKRSEEIRNQAVNNMKKNGIDALIVIGGDGSYRGAKKII
DYGFPCIGIPGTIDNDVAGTDYTIGYFTALNTIVEAIDRLRDTSTSHKRISIVEIMGRYC
GDLTLSATIAGGCEFVVLPEIPFDKKKLLEEIKYGLLKGGGRHAIVAITEYIYDVNKLAK
HIEKETGHETRATILGHVQRGGKPVACDRVLASRMGAYSVELLLKGYGSHCIGIRNDQLI
YQEISEALEGTKKRFKYDWLKIIKMLNWSENSYR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcgaggaaaaataaaaagaataggaattttaacaagtggaggagatgcgcct
ggaatgaacgctgcgattcgaagcgtagttaagatgagcatctctcaaggtttagaaata
tatggaattcatgatggttacatgggtctttatgagaataggattgaaaagttaaataat
ggattagtttcagatattattagtaaaggaggaacatttttaggatcagctcgatttcct
gaatttaaaagaagcgaagaaatccgaaatcaagcagtaaataacatgaaaaaaaatgga
atagatgctttgattgttataggaggagatggatcgtatagaggtgcaaaaaaaatcatt
gattatggttttccttgcattggaattcctggaaccatcgataatgatgttgctggaacc
gattatactataggatatttcactgctcttaatactatagtagaagccatagatcgacta
agagatacttctacttcacataaaagaatatctatcgttgaaataatgggacgatattgc
ggagatctcactttatctgcaaccattgctggaggttgcgagtttgtagttttgccagaa
attccattcgataaaaaaaaactattagaagaaatcaaatatggtcttttaaaaggagga
ggaagacatgcaattgttgcaattacggaatatatatacgacgtaaataaattggccaaa
catatcgaaaaagaaactggtcatgaaacaagagctacgatactcgggcatgttcaaaga
ggaggaaaaccagtagcatgtgatcgagttcttgcatctagaatgggagcatattctgtg
gaacttcttttgaagggatatggaagtcattgcattggtattcgaaatgatcaattaatc
tatcaggaaatttctgaagcattagaaggaacgaaaaaaagattcaaatacgattggttg
aaaattattaagatgttaaactggtcagaaaactcgtatcgataa

DBGET integrated database retrieval system