KEGG   Candidatus Riesia pediculicola: RIEPE_0150Help
Entry
RIEPE_0150        CDS       T01218                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00230  Purine metabolism
rip01100  Metabolic pathways
Module
rip_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RIEPE_0150
Enzymes [BR:rip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RIEPE_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_22 AAA RsgA_GTPase AAA_25 ABC_tran MMR_HSR1 AAA_18 AAA_30 TIP49 RNA_helicase Cytidylate_kin AAA_33 AAA_19 AAA_5 NACHT IstB_IS21 AAA_28 CbiA T2SSE
Motif
Other DBs
NCBI-ProteinID: ADD79512
UniProt: D4G7V8
Position
complement(145926..146573)
Genome map
AA seq 215 aa AA seqDB search
MKKTILGKVFIVSAPSGTGKSSLLRALAKKIQRNTKFSISYTTRKIRPKETNAKNYFFVS
VEEFQRMIRRNDFLEYASIFGNYYGTPKRFVEDNIKLGFDVILEIDWIGTKKVLKEIPSS
KSIFILPPCKKTLRKRLLDRKQDDRESIQFRMQNVVKEIKNCPKYHYIVINDNFDSALQD
LHSIITSEHLRSKEQIIRNQDLIYNFFKNDIFYEN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaattctaggaaaagtttttattgtttcagcaccgagtggaacaggaaaa
tccagtttattaagagctttagcaaaaaagattcagagaaatacaaagttctctatttca
tatactactagaaaaattagacctaaagagacaaatgcgaagaattatttctttgttagt
gttgaagaatttcagagaatgattagaagaaatgattttttggaatatgcttccattttt
ggaaactattatggtactccaaaaagatttgttgaagataatattaagttaggttttgat
gtaattttagaaattgattggataggaactaaaaaagtacttaaagaaattccatcttca
aaaagtatatttatcctacctccgtgtaaaaaaactcttcgaaagagattattggataga
aaacaagacgacagagaatcaatacaatttagaatgcaaaatgttgtgaaagagattaag
aattgcccgaagtatcactatatagttattaacgataattttgattcagctcttcaagat
cttcattcgatcattacatcagaacatcttagatcaaaagagcaaatcataagaaatcaa
gatttaatctataatttttttaagaacgatatattttatgaaaattaa

DBGET integrated database retrieval system