KEGG   Candidatus Riesia pediculicola: RIEPE_0464Help
Entry
RIEPE_0464        CDS       T01218                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00900  Terpenoid backbone biosynthesis
rip01100  Metabolic pathways
rip01110  Biosynthesis of secondary metabolites
rip01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RIEPE_0464 (ispE)
Enzymes [BR:rip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RIEPE_0464 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADD79519
UniProt: D4G8P6
Position
442883..443776
Genome map
AA seq 297 aa AA seqDB search
MIFWPSPAKINLFFRVNKKREDGYHEIQTLYHFLNYGDTIGINERRDEKIKLLYNSKFKG
LIKNNLILQAASLFQKYCMNNFPEKKFSGVNIYVKKVLPIGSGLGGGSSNAATTLVALNY
HWRTKISKRILCSISSNLGADVPFFVNGKTSIGEGIGQNLHPIQIIPKWYLIAYPKVSVS
TKEIFKKLNLKKISDRIPREILLNNKYQNDLEEFVKHSFPEVKKCINWFKKKSLSPIMTG
TGSCIFVQFSSKSDALKILKSIPKWMECFVAEGANDSPLYTFKSYIMKEKFKREDHI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatattctggccctctcctgctaaaattaatttatttttcagggtaaataaaaaaaga
gaagatggatatcatgaaatacaaaccttatatcattttttgaactacggagatacgatc
gggatcaatgaaagaagagatgaaaaaattaaactgttatacaattcgaaatttaaaggt
ttgatcaaaaataacttaatcttacaagcagcttctttatttcaaaagtactgtatgaat
aattttccagaaaaaaaattttctggagtaaacatttatgttaagaaagttctaccaatt
ggatcaggattagggggcggatcttctaatgctgctactactttagtagctttgaattat
cattggagaacaaagatatcaaaaagaattttatgtagtatttcaagcaatttaggagca
gatgttccattttttgttaatggaaaaacttctattggagaaggtattggacaaaatctt
catccaattcaaataattccgaaatggtatttaatagcatatcctaaagtttctgtatct
actaaagaaattttcaaaaaattaaatctaaaaaaaatatctgatagaattcctagagaa
atccttttaaacaataaatatcaaaacgatttggaagaatttgtaaaacattcttttcct
gaagtaaaaaaatgcataaattggtttaaaaaaaagtctctatctcctatcatgacagga
acaggatcttgtatttttgttcagttttcttcaaaatcagatgcattgaagatattaaag
agtattccgaaatggatggaatgttttgtggccgagggagctaacgattctcctttgtat
acatttaaaagttacataatgaaagaaaaatttaaacgagaagatcatatataa

DBGET integrated database retrieval system