KEGG   Rhizobium sp. IRBG74: BN877_I0436Help
Entry
BN877_I0436       CDS       T02867                                 

Gene name
apaG
Definition
(GenBank) ApaG protein; unknown function
  KO
K06195  ApaG protein
Organism
rir  Rhizobium sp. IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN877_I0436 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CDI07351
UniProt: U4PTP5
Position
complement(426987..427379)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVDPYYLEEQSDPDDDRYVWGYKVVIANNSDVPVTLVNRYWHITDQNGQ
VDEVYGPGVVGEQPHLKPGDTYEYSSGCPLDTPSGLMFGHYEMETESGEVFNVTIPAFSL
DSPGLMRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtgctctgacaagggatatcgaggtgacggttgatccgtattatctcgaagaa
caatccgacccggatgacgaccgctacgtctggggctacaaggtcgtgatcgcgaataac
tcggatgttcccgttactctcgtcaatcgctattggcatatcactgaccagaacggtcag
gtggacgaagtctacggaccgggtgtcgtgggagaacaaccgcatctcaagcccggcgac
acctacgaatattcctccggctgcccgttggacacaccgtccggccttatgttcggacat
tacgagatggaaacggaaagcggagaagtgttcaacgtcaccatacccgctttttcgctg
gattctccggggctgatgcgggtcttgaactga

DBGET integrated database retrieval system