KEGG   Rhizobium sp. IRBG74: BN877_I2277Help
Entry
BN877_I2277       CDS       T02867                                 

Definition
(GenBank) putative Two-component transcriptional regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN877_I2277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rir02022]
    BN877_I2277
Two-component system [BR:rir02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BN877_I2277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: CDI09168
UniProt: U4PVT8
Position
2174041..2174754
Genome map
AA seq 237 aa AA seqDB search
MAQAPAKRPPADDDAAHLLIVDDDARIRDLLQRFLGDKGYRISVAADAAEARRKMVGIRF
DLLILDVMMPGENGLSLTRSLNEDKSVPVILLTARSEADSRIAGLEAGADDYLAKPFDPR
ELVLRINNILRRNTSPDTPKIEQIMFGPYSFSIPRRELRRGPETIRLTDREQEIMLLFAL
RAGDTIPRHELVEAESEVGERTIDVQINRLRRKIEDDPANPVYLQTVRGIGYRLSVD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagctccggcaaaacgtccaccggcggacgacgatgcggctcatctcctgatc
gtcgacgatgacgcccgcatccgcgatctcctgcagcgttttcttggcgacaagggatat
cgcatctccgttgcggccgatgcagcagaagcccgccgcaagatggtgggcatccgtttc
gatctgctgatcctcgacgtgatgatgcccggagagaacgggctttcgctgacccgctcg
ctgaacgaagataaatccgtgccggtcattcttctgaccgcccgctcggaagcggattca
cgtattgccgggctggaagcgggagcggacgattatctcgccaagccttttgatccgcgc
gaactggtcctgcgcatcaacaatattctgcggcgcaacacctccccggacacgccgaag
atcgaacagatcatgttcggcccctacagcttctccattcccagaagggaactgcggcgc
ggtccggaaacgatccgcctgacagatcgtgaacaggagatcatgctgctttttgcgcta
cgcgccggcgataccattccacggcacgagctggtggaagcggagtcggaagtgggcgaa
agaacgatcgacgtgcagatcaaccgtcttcgccgcaagatcgaagacgaccctgccaac
ccggtctatctgcaaacggtgcgtggcatcggttaccgcctcagcgtggactga

DBGET integrated database retrieval system