KEGG   Rhizobium sp. IRBG74: BN877_I2854Help
Entry
BN877_I2854       CDS       T02867                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00071  Fatty acid degradation
rir00072  Synthesis and degradation of ketone bodies
rir00280  Valine, leucine and isoleucine degradation
rir00310  Lysine degradation
rir00362  Benzoate degradation
rir00380  Tryptophan metabolism
rir00620  Pyruvate metabolism
rir00630  Glyoxylate and dicarboxylate metabolism
rir00640  Propanoate metabolism
rir00650  Butanoate metabolism
rir00900  Terpenoid backbone biosynthesis
rir01100  Metabolic pathways
rir01110  Biosynthesis of secondary metabolites
rir01120  Microbial metabolism in diverse environments
rir01130  Biosynthesis of antibiotics
rir01200  Carbon metabolism
rir01212  Fatty acid metabolism
rir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN877_I2854 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN877_I2854 (phbA)
   00640 Propanoate metabolism
    BN877_I2854 (phbA)
   00650 Butanoate metabolism
    BN877_I2854 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN877_I2854 (phbA)
   00072 Synthesis and degradation of ketone bodies
    BN877_I2854 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN877_I2854 (phbA)
   00310 Lysine degradation
    BN877_I2854 (phbA)
   00380 Tryptophan metabolism
    BN877_I2854 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN877_I2854 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN877_I2854 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN877_I2854 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rir04147]
    BN877_I2854 (phbA)
Enzymes [BR:rir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN877_I2854 (phbA)
Exosome [BR:rir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN877_I2854 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDI09737
UniProt: U4Q0Z1
Position
2776976..2778157
Genome map
AA seq 393 aa AA seqDB search
MTLPSIVIASAARTAVGSFNGHFANTPAHELGATVISAVLERAGVAANEIDEVILGQVLT
AGEGQNPARQAAMKAGIPQEATAFGLNQLCGSGLRAVALGMQQILTGDAGIVIAGGQESM
SMAPHCAHLRGGVKMGDFKMIDTMLKDGLTDAFYGYHMGITAENIARQWQLSRDEQDQFA
VSSQNKAEAAQAAGRFVDEIVAFTVKGRKADIVIDADEHIRAGASLETMAKLRPAFDKDG
TVTAGNASGLNDGAAATLLMSEQEAEKRGIKPLARIASWATAGVDPQIMGTGPIPASRKA
LAKAGWSVGDIGLVEANEAFAAQSCAVVRELGLDPDIVNVNGGAIAIGHPIGASGARVLN
TLIYEMRRRNVSKGLATLCIGGGMGVAMCIEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccttcaatcgtgattgccagcgctgcgcgcaccgccgtcggttctttcaat
ggccactttgccaatacgccagcccacgaactcggcgcgaccgttatcagtgccgtgctt
gaacgtgccggcgttgcggcgaacgaaattgatgaagtcattctcggtcaggtgctcacc
gcgggcgaagggcagaacccggcgcggcaagcggcaatgaaggcaggcattccgcaggaa
gcgaccgctttcggcctcaaccagctctgcggctcggggctgcgcgccgtggccctcggc
atgcagcaaatcttgacgggtgatgcgggcattgtcatcgccggcggtcaggaatccatg
tccatggcacctcactgcgcccatttgcgtggcggcgtgaaaatgggcgacttcaagatg
atcgacaccatgctgaaggacggcctgaccgacgccttttacggctatcacatgggcatc
accgctgaaaacatagcccgccagtggcaactctcccgggatgagcaggaccagtttgcg
gtctcatcgcaaaacaaggctgaagccgcacaggctgccggacgtttcgtggacgaaatc
gtcgctttcaccgtgaagggccgcaaggccgatatcgtcatcgacgccgatgaacatatc
cgcgccggcgcctcgctggaaacaatggccaagttgcgccctgccttcgacaaggacggc
accgtgacggcggggaacgcctcaggtctgaacgacggcgcagccgccacgcttttgatg
tcggaacaggaagcagaaaagcgcggcatcaagccactggcccgtattgcctcctgggcg
acggcgggcgtcgatccgcagatcatgggcaccggccccattcccgcctcccgcaaggcc
ttggccaaggccggctggtcggtaggcgatatcggcctcgtcgaagccaacgaagcgttt
gcagcccagtcctgtgccgtcgtgcgcgagcttggccttgatcctgatatcgtcaacgtc
aacggcggagcgattgccatcggccatccgatcggcgcttcgggcgcccgcgtcctgaac
accctgatttacgagatgcgccgccgtaatgtgtccaagggtcttgcgacactctgcatc
ggcggcggcatgggtgtagccatgtgcatcgaggcgctctga

DBGET integrated database retrieval system