KEGG   Rhizobium sp. IRBG74: BN877_II0853Help
Entry
BN877_II0853      CDS       T02867                                 

Definition
(GenBank) Zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN877_II0853
Enzymes [BR:rir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BN877_II0853
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BN877_II0853
    1.1.1.-  
     BN877_II0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: CDI10649
UniProt: U4Q083
Position
linear:874888..875961
Genome map
AA seq 357 aa AA seqDB search
MRALRFHAAKDLRLEDIPEPRQAGPGQVIVRNRFVGICGTDLHEYSYGPIFIPTEPHPFT
GAHGPQVLGHEFGGVVEAIGEGVTSVAIGDRVSIQPLVMPRSGDYFADRGLFHLSPQLAL
VGLSWNGGGMAEAALVHEYNVQKIPDEMTDEEAALVEPTAVAVYACDRGGVTAGNSVLVT
GAGPIGMLTLLAARAAGATKLFVSDLNDARLEIAKKVLPDLVAINPKREKVGDVVRAQTE
GQVGCDVAIECVGNEHALKACVDAVRKQGVVVQTGLHPHENPIDWFQVTFRDLEVKGSWA
YPTHYWPRVISLISSGLLPATKIVTKRVTLETAVKEGFDALLDPAGTHLKILIDLSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctcagatttcacgccgcaaaggacttgcggctcgaggacatccccgagccg
agacaggcgggaccgggccaggtcatcgtccgcaaccgcttcgtcggaatttgcggaacg
gatcttcacgaatacagctatggcccgatcttcatcccgaccgagccgcatccgtttacc
ggcgcccacggccctcaggtcctcggccacgagttcggcggcgttgtcgaagccatcggt
gaaggcgtgacctcggtcgccatcggcgaccgcgtctcgatccagcctctcgtcatgccg
cgctccggcgactacttcgccgaccgcggccttttccatctcagcccgcaactcgcactc
gtgggtctcagctggaatggcggaggcatggctgaagccgcgctggttcacgaatataat
gtccagaagatcccagacgagatgaccgatgaagaggccgcactcgtcgagccgacggcg
gttgccgtctatgcctgcgaccgtggcggcgtcaccgccggtaacagcgttctcgttacg
ggtgccggcccgatcggcatgctgacgctgctggcggcccgagcggccggtgccaccaag
ctgttcgtctcggacctgaacgatgcccgcctcgagattgccaagaaagtcctgcccgac
cttgtcgccatcaatccgaagcgcgagaaggttggcgatgtcgtccgcgcccagaccgag
ggccaggtgggatgcgacgttgcgatcgaatgcgtcggcaacgaacacgccctgaaggca
tgcgtggatgctgtgcgcaagcagggcgtcgtcgttcagacaggtctgcatccgcatgag
aatccgatcgactggttccaggtcacgttccgcgatctcgaggtcaaaggctcctgggcc
tatccaacccattactggccgcgtgtcatcagcctgatctcatccggcctcctgccggcg
acgaagattgtcaccaagcgcgtcacgcttgaaacggccgtgaaagagggcttcgacgcc
ctcctcgatccggctggcacccacctgaagatcctgatcgatctctcgaaataa

DBGET integrated database retrieval system