KEGG   Rhizobium sp. IRBG74: BN877_II1530Help
Entry
BN877_II1530      CDS       T02867                                 

Definition
(GenBank) putative sugar-nucleotide epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00520  Amino sugar and nucleotide sugar metabolism
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN877_II1530
Enzymes [BR:rir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BN877_II1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short
Motif
Other DBs
NCBI-ProteinID: CDI11316
UniProt: U4QC99
Position
linear:1599032..1600054
Genome map
AA seq 340 aa AA seqDB search
MRNFVPNEHDNGVTIYSDWKPGQRVLVNGGAGFLGSHLCERLLSSGHEVICLDDLSTGRT
ANVEHLRNNKRFLMVEHDVRKPYDIDVSLIFNFASPASPPDYQRDPVGTLLTNVLGAVNV
LEVARRCGATVVQSSTSEVYGDPHVNPQPETYFGNVNTIGPRACYDEGKRSAETLFFDYH
RTFGVDIKVGRIFNTYGPRMRPDDGRVVSNFIVQALKGDDITIYGDGSQTRSFCYVDDLI
DGFLRFSAKPKDCTGPINLGNPTEIPVRQLADIVIRMTGSRSRIVHLPAAIDDPQQRRPD
ISRANELLKWQPRVPLEIGLERTIVYFDALLAGRKVAEAV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatttcgttcccaacgaacatgataacggcgttaccatttactcagattggaaa
cccgggcaacgggtactcgttaatggtggcgccggtttcctgggctcccatctctgcgag
cggttgctgagcagcggtcacgaggtgatctgtctcgatgatctttcgaccggccgtacc
gcgaatgtggagcatttgcggaacaataagcggtttctgatggtcgagcacgatgtgcgc
aaaccctatgacatcgatgtttcgctgatcttcaactttgcctctccggcttcgccgcct
gattatcagcgcgatcccgtcggtacccttctcaccaatgtactcggcgcagtcaatgtg
ctggaagttgcgcgcagatgcggtgctaccgtggtgcagtcctcgacctcggaagtctat
ggcgatccccacgtcaatccgcaaccggaaacctatttcggcaatgtaaatacaatcggg
ccgcgcgcctgctacgatgaagggaaacgcagcgcggaaacgctgtttttcgattatcac
cgcactttcggtgtcgatatcaaggtcggacgcattttcaacacttacgggccgcgtatg
cgccctgacgacggccgtgtggtttcgaacttcatcgttcaggcgctgaagggggacgac
atcaccatttacggtgatggcagccagacccgttctttctgctatgtcgatgacctgatc
gatggcttcctgcgcttctcggccaaaccgaaagactgcaccgggccgatcaatctcggt
aatcccacagaaattcccgtgcggcagctggccgacattgttatccggatgacaggttct
cgctcgcgcatcgtccatctgcctgccgcgatcgatgatccgcagcagcgtcgtccggat
atttcgcgggcaaacgagctgctgaaatggcagccgcgtgtaccgctcgaaatcggcctt
gaaagaacgatcgtctatttcgatgcgttgctggcgggccggaaagtggcggaggccgta
tga

DBGET integrated database retrieval system