KEGG   Rivularia sp. PCC 7116: Riv7116_0437Help
Entry
Riv7116_0437      CDS       T02364                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00020  Citrate cycle (TCA cycle)
riv00640  Propanoate metabolism
riv00660  C5-Branched dibasic acid metabolism
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01120  Microbial metabolism in diverse environments
riv01130  Biosynthesis of antibiotics
riv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Riv7116_0437
   00640 Propanoate metabolism
    Riv7116_0437
   00660 C5-Branched dibasic acid metabolism
    Riv7116_0437
Enzymes [BR:riv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Riv7116_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AFY53040
UniProt: K9R560
Position
complement(558782..560014)
Genome map
AA seq 410 aa AA seqDB search
MELLEYQVKEWFGKMGIPVLPSQTIDHPTDLKRLKIDYPIVLKSQIYGGGRAKAGGVRFV
ETTIDAIATAQNIFNLSIYGELPEVLLAEAKYNIEQELYLAIVLDTAVCRPILLGCNEAD
IDWEEAGEKMQHVVVEEQFSPFYARRLALKMGLQGALMQSVSEVIENMYRLFVEKDLDLV
EINPLGVNSSGQVMALNGNVSINERAIRRHQEIAVIARKLVSRNISKDTNGNFGNWDGVG
MHGKIGVLGNGAGSVMATLDLVVSNGGKPGVCLNLRHAFLTDTMPTTFNTRLQKALQILA
ADKSIKVILINFLGSIPQAKEVAEVIANFVKQQSSPNSQEFVSDGNKNRRRGFSLPRLVI
RLAGSDLDTAKNYLSDLTNVAQNPILLVESLDEAVTQAVKITKENVKRQR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaattattggaatatcaagtaaaagaatggtttgggaaaatgggtattccggtatta
ccttcccaaacaatcgatcatcctaccgacttaaaacgtttgaaaatcgactacccaata
gttttgaaatctcaaatttatggaggaggaagagcaaaggctggcggagtcaggtttgtc
gaaactacaattgatgcgatcgcgacggctcaaaatatttttaatctgtcgatttatggt
gagctgccagaagtactattggcagaagcgaaatacaatatcgaacaagaactgtattta
gccattgttttagataccgctgtatgtcgtccaatacttttggggtgcaatgaagcggat
atagattgggaagaagctggagaaaaaatgcagcacgtggtggtagaagagcagttttct
cctttttacgctcgaagactagccttaaaaatgggtttgcaaggtgccttgatgcagtcg
gtaagcgaggttattgaaaatatgtaccgattgtttgtcgaaaaagacctagatttggtc
gaaatcaacccattaggagtaaattcttcgggacaggtaatggctctgaatggaaacgtt
agtattaatgaaagagcgattcgtcgtcatcaagaaattgctgtaatagctcgtaaatta
gttagccgtaatatctcaaaagatacaaatggcaacttcggcaattgggatggagtagga
atgcatggtaaaataggtgttttgggaaatggcgctggttctgtaatggcaactctagat
ttagttgtaagtaatggtggaaaaccaggagtatgtcttaatttgcgacatgcattttta
accgatactatgccgactacttttaatactcgtttgcaaaaggctctacaaatcctagct
gctgataaaagcatcaaagtaatactaattaattttttaggtagtattcctcaagcaaaa
gaagttgcggaggtaattgcaaactttgttaagcaacaatctagtccgaactcgcaagag
tttgtttctgatggtaataaaaatcgtcgcagaggtttttctctacctcgattagttatt
cgcttagctggttccgacttagatacagccaagaattatttatcagatttaacaaatgtt
gcccagaatccgatattactcgtagaaagtttagatgaggcagtgactcaggcagttaaa
attacaaaagaaaatgttaaaaggcaacgataa

DBGET integrated database retrieval system