KEGG   Rivularia sp. PCC 7116: Riv7116_1883Help
Entry
Riv7116_1883      CDS       T02364                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01130  Biosynthesis of antibiotics
riv01230  Biosynthesis of amino acids
Module
riv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Riv7116_1883
Enzymes [BR:riv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Riv7116_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth FMN_dh NMO Dus
Motif
Other DBs
NCBI-ProteinID: AFY54424
UniProt: K9RAP9
Position
complement(2320107..2320952)
Genome map
AA seq 281 aa AA seqDB search
MNNVTTTNRIHMLTRPRHILEEIVLHKRQEVAQMRLESPLAKVQEQLKDAPKVRDFLKAL
QDNSHSPSLIAEVKKASPSKGIIREDFDPVNIAQAYEKGGAACLSVLTDSRFFKGSFDNL
RRVRKSVELPLLCKEFIVDLYQIYLARTAGADAVLLIAAILSDVQLKDFLRVIHSLKMTA
LVEVHTPSELDRVLRLPDVKLVGINNRNLKNFTVDLANTEKLIAQRKSQLQSFGITVISE
SGIYTPDDLDFVEKAGARAVLVGESLVRQPDVEDAVRKLLG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgtgacaactaccaatagaattcatatgctaactaggccccgacacatactt
gaggaaatagtcttgcataaaaggcaagaagttgctcaaatgcgattggaatctccttta
gctaaggtgcaagaacaactaaaagatgcaccaaaggtaagagattttttaaaggctttg
caagataattctcacagtcctagtttaattgcagaagtaaaaaaagcatcgccaagtaaa
ggaattattcgggaagattttgacccagttaatatagcccaagcatatgaaaaaggggga
gccgcctgtctttcagttctcacagacagtcgtttttttaaaggtagctttgacaaccta
cgtagagttagaaaaagcgtagaattaccgctattatgcaaagaatttattgttgattta
tatcaaatatatttagctagaactgcgggcgctgatgcagtactcttgattgcagcgatt
ttatccgacgtacagttgaaagactttttgcgggtaattcacagcttgaaaatgacagct
ttagtagaagtccatactccttcagaattagatagagtgttaagacttcctgacgtaaaa
ttggtcggaataaacaaccgcaatctcaagaatttcactgtagatttagcaaatacagaa
aaattgattgctcaaagaaaatcgcaattgcaaagtttcggaattaccgttattagcgaa
tctggtatatatacacctgatgatttagatttcgtcgaaaaagctggcgctcgtgccgtt
ttagtcggagaatctttagttaggcagcccgatgtggaagatgcggtacgaaagctgctc
ggataa

DBGET integrated database retrieval system